Dataset for protein Unclassified of organism Eidolon helvum adenovirus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A348FKF5_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Eidolon helvum adenovirus (length=161 residues).
MERPEEIPFCFETTKNLLLQTYKFSKSNWFWRKFFSPPFIFAVLEARKTYKEEFQGNLNADLCINVFFDTLDWGNFQNSL
IRHLDFSSFGRAVASIAFLSTIIERLEEVTCFSVPFIIESFSYAIWQWAISSKKSPTSRLKTSRLTKTQEKAMEELSKSL
L
© 1998-2019