Dataset for protein Unclassified of organism Deer mastadenovirus B

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1Y0B6F3_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Deer mastadenovirus B (length=157 residues).
MDHLDILIDLRLLRSVIAGASNRTGAWKRRLWLGRLTQLVHNICSENQESFLNSLPGNANFLRLLRTGYFEVYDVFVVPE
LHLDSPGRVVAALALLVFILNDLDAHSAASGFDSGFLIDRLCVPLWLKARAYKITQSSRTNLQPSSSPDKTTPTSSQ
© 1998-2019