Dataset for protein E1B 19K of organism Cynomolgus adenovirus 1

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1C8EG46_E1B19K-01 E1B19K protein OS=[Viruses] Cynomolgus adenovirus 1 GN=E1B19K (length=211 residues).
MINDVNFVCLFKGDYLGGIKGAVVRLGHFTMDLRVELQTFESTRCLLELCSNRASWWKRLLFGTSLCRLVRQVKEEYQSE
FEHILSTCQGLFESLELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWNTQTQLSPGYTLDYISLQLWRFWLRRR
VYNYSRGLPPLGRASSPEEQLPEVKPEVAGQGEEQEQKPALRSGLGPPEEN
© 1998-2018