Dataset for protein adenoviridae of organism Chimpanzee adenovirus Y25

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G9G841_E1B19K-01 E1B19K protein OS=[Viruses] Chimpanzee adenovirus Y25 GN=E1B19K (length=187 residues).
MEIWTILEDLHKTRQLLENASNGVSHLWRFCFGGDLAKLVYRAKQDYSEQFEVILRECPGLFDALNLGHQTHFNQRIVRA
LDFTTPGRSTAAVAFFAFLLDKWSQETHFSRDYQLDFLAVALWRTWKSQRLNAISGYLPVQPLDTLKILNLQESPRARQR
RRQQQRQQEEDQEENPRAGLDPPAEEE
© 1998-2018