Dataset for protein Unclassified of organism Canine mastadenovirus A

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1J0MUK8_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Canine mastadenovirus A (length=169 residues).
MDPLKICENYLTFRSIIKGSTFSPGVFRRWRFHALADVVGNIVEREEGRFWEIVPETHTLWALFRGGFTVAPFTEILTSL
QLENRGRQLAFLAFLSFLLRNWPSDSVVSEDARLDLVCAPAWSRIQIWSQAARLINDLPESVFEGQGSVVEEECGEEHLA
RDSDDPFFD
© 1998-2018