Dataset for protein Unclassified of organism Canine adenovirus serotype 2

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|P14265_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Canine adenovirus serotype 2 (length=169 residues).
MDPLKICENYLTFRAIIRGSTLSPGFFRRWCFPALADVVGNIVEQEEGRFWQILPENHAFWGLLRRGFTVASFTEIITAA
QLENRGRQLAFLAFISFLLRNWPSDSVVPEADRLDLVCAPAWSRMQIWSQTARLINDLQDSVLEEQGSAEEEECEEALLA
GDSDDPLFG
© 1998-2018