Dataset for protein Unclassified of organism Canine adenovirus serotype 1

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|Q65942_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Canine adenovirus serotype 1 (length=169 residues).
MDPLKICENYLTFRSIIKGSTFSPGVFRRWRFHALADVVGNIVEREEGRFWEIVPETHTLWALFRGGFTVAPFTEILTSL
QLENRGRQLAFLAFLSFLLRNWPSDSVVSEDARLDLVCAPAWSRIQIWSQAARLINDLPESVFEGQGSVVEEECGEEHLA
RDSDDPLFD
>gnl|bcl2dbpro|Q96678_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Canine adenovirus serotype 1 (length=169 residues).
MDPLKICENYLTFRSIIKGSTFSPGVFRRWRFHALADVVGNIVEREEGRFWEIVPETHTLWALFRGGFTVAPFTEILTSL
QLENRGRQLAFLAFLSFLLRNWPSDSVVSEDARLDLVCAPAWSRIQIWSQAARLINDLPESVFEGQGSVVEEECGEEHLA
RDSDDPFFD
© 1998-2018