Dataset for protein Unclassified of organism California sea lion adenovirus 1

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A059XJ33_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] California sea lion adenovirus 1 (length=147 residues).
MEQLKDYSFFKEVVEHASLRTGNLYRFFFSSSLAKVVFQVYLEKVGEFDRLDSTASALLALSQGNNFLFEKLIIPELPFY
SFGHILASLAFCSFCVNKADISATVSSGFILDAVCRPAWQKFMMSHNMMENQTGSSEFSLEEALTDN
© 1998-2018