Dataset for protein Unclassified of organism Bovine adenovirus B serotype 3

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|G9HQG8_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bovine adenovirus B serotype 3 (length=157 residues).
MDHLSFLLDLKLLRSIVAGASNRTGVWKRRLWLGRLTQLVHDTCVENESIFLNSLPGNEAFLRLLRSGYFEVFDVFVVPE
LHLDTPGRVVAALALLVFILNDLDANSASSGFDPGFLVDRLCVPLWLKARAFKITQSSRSTSQPSSSPDKTTQTTSQ
>gnl|bcl2dbpro|Q64843_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bovine adenovirus B serotype 3 (length=157 residues).
MDHLSVLLDLKLLRSIVAGASNRTGVWKRRLWLGRLTQLVHDTCVENESIFLNSLPGNEAFLRLLRSGYFEVFDVFVVPE
LHLDTPGRVVAALALLVFILNDLDANSASSGFDSGFLVDRLCVPLWLKARAFKITQSSRSTSQPSSSPDKTTQTTSQ
© 1998-2018