Dataset for protein Unclassified of organism Bovine adenovirus 2

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q9EEG2_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bovine adenovirus 2 (length=159 residues).
MDLSLQLCEQLSSLPQLRRVIYYATNRASWWSRTFFGGRLANLVYTIKVEEAESLQELFNEDEGFWQMFGSGRTLGYESK
IVPWLDFSTPGRATASLSLLAYIVDCLDKQSELSSDFILDAVCGPVCYKLKMLLSLQKLQGHLSGSSVGSTCHSREETD
© 1998-2018