Dataset for protein Unclassified of organism Bottlenose dolphin adenovirus 1

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A0M4LS43_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bottlenose dolphin adenovirus 1 (length=219 residues).
MDLKFLELLGKRDYLRRLLENASLRTSSFYRFIFCDSLTKLVYTAWEQYHQNFDEILPQGSSFWVVLNSGRIGALHGALQ
SVDFSSNGRGIASLAFLVNILNHLDASGAYSKGFTSEILSLLVWPKIRFVLNYKKIAALEAEVYPSMSTSRLPPITRMVP
MNRIRDQEQEANVEQPEDEVPAQNLFNPRTPPLSSSSSQSSQNSLDSESESDEGWLAMD
>gnl|bcl2dbpro|A0A1X7MN46_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bottlenose dolphin adenovirus 1 (length=183 residues).
MDLKFLLALDNKKYLEKLLVLASKRTSFLYRTFFADDLIKLVHSASNDYKSNFEDVLPAGCSFWILLGSGKIGTLQGLLH
SVDFSSNGRGVASLAFFVHILNCLDEFLFFSKTFNLEVLVNTLWPTIHCALNQQRVNVLQGAMNQLTETPVPSIESLISP
ESSGSENESDPVAELEEGSLETE
© 1998-2018