Dataset for protein Unclassified of organism Bat mastadenovirus WIV9

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A163HHM5_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bat mastadenovirus WIV9 (length=317 residues).
MDYLKFLTNYAVLKRIIRDSSERTGPWRRYFFCGPLANFIHKIKEENKELFAQCLDSEGQFLELLRSGDLALYNTKVVPA
LQFENPGRVASSLAFVVWLLDQWDLQNQFSPEFSLEALCIPVWKIIKQEVAQRELGTAARVFQQELEREGLIDPPGSMVG
ETPEREDTEEGELHLAEPAVIQETESEGEEEEMPPLEESESEEESMGEEELEEVETEEDSELEVVFAAENEVLSPTPDLL
RQAAVSGLSSSSEEQCFSPLSGVAPLASSDSSCSEPEEEERVVPPSGGRAIRVSVIVHAPAQGTGGAQGQSSSGGRM
© 1998-2018