Dataset for protein Unclassified of organism Bat mastadenovirus WIV18

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1X9RIT9_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bat mastadenovirus WIV18 (length=168 residues).
MERAIDIPFSFQGLRHILTLSYKASKSSWFWRKFCTPSLILAIVDAKESYAEDFNSFLTTDFCLQSFLDTLDWPSLEKSL
IPNLDFSSPGRAIASLAFLSSIIDRLEFATVFTPSYLIENFSFAVWRWAITLTKESRTSEQSKMLKMKTPDLTEKQEEAL
MELIKSWD
© 1998-2018