Dataset for protein Unclassified of organism Bat mastadenovirus WIV13

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1B0UHW6_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bat mastadenovirus WIV13 (length=139 residues).
MEANYIQYLKSYSDFRDLLNGASARTGFLYRWLFCDKLTYWVYRVKIENRVIFEEIVKDFPETFFESLEAGYTCDFEDSI
VPQLEFLSLGHTLSSLAFVVFLIDYWKENSVFSWDFIIESFGLITWRAIIMAFTREKLL
© 1998-2018