Dataset for protein Unclassified of organism Bat mastadenovirus G

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1J0FAP3_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bat mastadenovirus G (length=181 residues).
MDLFSMCADYSSFRYILRGSLCGSSWVRKWCFPALADAITGIADDYEDGYWRAFPPDDINWNLLRRGYTFAAFTDLFSSV
DLGNAGRFMSFLGFLNFILRNWPSDSVVLSADRLDLICVPAWTKIMLWSQTMRQMEELQLLEMAAAQAAAAARGARAEET
SETTPLLQSTSTQTEQLETDL
© 1998-2019