Dataset for protein Unclassified of organism Bat mastadenovirus A

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3G9ETB4_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bat mastadenovirus A (length=182 residues).
MDPLALCADYSTFRFIIRGSLCGSGWVRRFCFPALANVLAEVAEEYEEGYWRAFPPEDYNWDLLRRGYTFAAFVDLFSTV
DLSNGGRVLSFLGFLSFILRYWPSDSVVPAADRLDFICIPAWTKMQLWIQSLRFMEELESAIAARRADTGSDPAPAPAEE
PTQPVRLRAITRSTQTDLDHQD
© 1998-2019