Dataset for protein Unclassified of organism Bat adenovirus 2

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1FQL6_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bat adenovirus 2 (length=180 residues).
MDLLRACSTYSAFKYMMKGSTYNSGWVRRWCFPGLSEVVGTLAETHSYRFWNMMPRRHLYWDLVRRGYCTSFFEIMFRKA
DLSNRGRVLAYLAFVSFLLRNWPQDSVVPEADRLDLICIPAWTRMQSWQQTVTLMQEIEEIQQGTGAEECTDAEQAFVEE
EEEQGGGSSPDPLTEGSMQP
© 1998-2018