Dataset for protein Unclassified of organism all

[Download (right click)]

194 sequence(s)

>gnl|bcl2dbpro|A0A3Q1EM73_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Acanthochromis polyacanthus (length=198 residues).
MAAAYSSHEIVEDYLHHKLLSRGVVWPRPPPGRGGDADDILQDLGLAPPPLQAALRTAGDELARCYHGDLWAQVSVRLCG
DGGGVVQRHSLTAVSRELFRDGVNWGRIVAMMELGGALSTEAAEAGLTCQVDDIAGWMEDSLDSPPLRGWIQDNGGWDAF
LQLYDSRPPVTSWSLRTVVGLVVLGAVGIILGVLFSQK
>gnl|bcl2dbpro|B7SB93_uncBCL2L2-01 Putative BCL2-like 2 protein OS=[Eukaryota] Acropora millepora (length=186 residues).
MVHNNDRLRSFNTIVKDYVGYKLRQKNIFLDGYNVNESPSAAACHLRRVADELIEENRQLFDSMCDQLHLTHASTYATFV
GIADEIFQTGKNWGRIVAFLAFGATLAVYCVQKEDLAELLDNIIEWLSLYMEQNLGQWINENGGWEGFIQFFKKEDGSPG
NGRNGGWRIAAVAGLGIGALLMLACR
>gnl|bcl2dbpro|B7SB94_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Acropora millepora (length=211 residues).
MAGATAALNNEDLSPTLSTSELSRYDKDIVNDGYSLTVDYVSYRLRNKFEQNKLSGLPRKFLIPQSPISASSSNLRKLAT
LMEAEHPDLFESLCTTLGITPNTAHPTFVGVAQEIFQAGINWGRIVALFTFGGVVAHHFVEIQRLEMVQRIVEWIADFIE
HNLLTWIRENGGWDGFVAHFSDSSQSQFTWKSLVTVGSICAAGLTLLALNK
>gnl|bcl2dbpro|A0A3Q0S1A1_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Amphilophus citrinellus (length=197 residues).
MQYSNRELVEFFISYKLSQRNHPTPLLRPSDAGQRTEEDQANSWPAHHGVEAVKSALIDSGEQFGFLFTQSFQDVASHLS
ITPDTAQQCFKNVMDELFRDGINWGRVIGLFVFGSAMCADCVENNMSEMVPHIADWMTVYLDEHINLWIQRHGGWDRFTE
IFGKGMSARRSRESLKRWLFVGVALVTGLLVGMLMAD
>gnl|bcl2dbpro|A0A3Q0SHK0_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Amphilophus citrinellus (length=194 residues).
GAMAAAYSSRDIVEDYLHYKLLCRGVAWPSAPPPHRPDPRVAPPRLQIVLRSAGDELERLYGAELSAQVSVLRLRGDGGD
AARLRNMTAIREELFRDGVNWGRIVTMMELGGALSAEVAMTGDTGHVDDIAGWMEESLDSPLLQRWIQDNGGWDAFMDLY
ESRPADSFWALSTMFGLVVLGAAVVILGFLFSQK
>gnl|bcl2dbpro|A0A1X7U9C1_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Amphimedon queenslandica (length=229 residues).
MAVALQPRHVTATSPVPEERRKKDTTWTPSSTQASNILANTDFAYQTKEIIHETFYGLLLEQGLKLNGGHVEPIFTSETN
RKVYSSLMGACKQFLRLHSDQIRRDMEQLDISETALCVTFHSTMHSMFSDCINWGRIVALISFAVLVAYKAHKTSRHVVE
SIEGWLITFICQNLSQFIMKQKGWASVPDRFSSNKIGGDIVDAKNGGGSWLALAAVGVGAALVTAFLSK
>gnl|bcl2dbpro|A0A1X7UKJ6_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Amphimedon queenslandica (length=234 residues).
MAVALQPRHLTSTSPVPERRKKDAKWTPSSTQGAHASNILANTDFVHQTKEIIHEVFYALLLEQGVKLNGYTTGHVEPIF
SSETNRKVYNSLMGACRQFLRLHSDQIRRDVEKLDISETTLCITFHSTMHSIFSDCVNWGRIIALISFAVLVAYKAHKTS
RHVVESIEGWLITFICQNLSQFIMKQKGWASVPDRFSSDKIGGDTVDAKNGGGSWLALAAVGVGAALVTAFLSR
>gnl|bcl2dbpro|A0A1X7UUJ1_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Amphimedon queenslandica (length=214 residues).
MALVVNPAPVQHQYHHKNSPKRRGSPVQDDKFYEETRNLITACIESASGKEPLSVKLSEEALRIVGMVQQTLKADEIFFR
KLCEELELTATNLFSKLMDVWGGMFSDGQVNIGRLLALLAFCQCVTVYCRSVGLPSIESSVPHWASIFISTTHLKDWITN
RGGWDAISKELMLRTSATNSSTSSRTASNGGWLQWGVSGIALAISVFDALHNSS
>gnl|bcl2dbpro|A0A1X7V1Y6_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Amphimedon queenslandica (length=229 residues).
MEVLSPSVTRQKGVHHHNLAMASTSSSIPSDSRIGRVVKRTVRSLLEKDGYRQEQALSLIDPVGQFGEDELLLVERIVNL
VLRLVDDPRQSRRITVADLEQNDWPLQPDNVHSEFKTVATQIFSDDINWGRIVSFLSFSSTYILFSMRRGMPESIVQSVC
GWTTSFMERELRSWFQSHSWEEFLSYGESILKARQRNGESERPIWQNLATIGAIGIGAAVLFSLRSSFS
>gnl|bcl2dbpro|A0A1X7VN87_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Amphimedon queenslandica (length=241 residues).
MNIITRALYKKKQIRQDLHLKAKKPSSKEKKNQKPIMSSVISQQEEKQSTSSAGGVKALTQSYIIEQLRQNGYKSLAASL
SKDQLTISEEMHKIVKRISNQLAQEKKEQMEDICFELQLTKETLTETFNGISQELFKDGIKWGRIVTFIAFSGAMAVYCA
QNSLGDQVSDVIRQTGSFIQDNLHQWILNNDGWCGFVRHFDEQDINLNFFVPAFFIGLGMTALAVAGSFLAFKRKYTGGL
L
>gnl|bcl2dbpro|A0A3Q1B7Q9_uncBCL2-02 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Amphiprion ocellaris (length=211 residues).
GAMAAAYSSRDIVEDYLQDKLVSRGVAWPCPPPGRTPRRRGTAEDVLLGEEAVCVDPGLAPPPLQAALHTAGDKLARCYH
GDLWAQVSVRLCRDGGGVVQRHSLTAVSRELFRDGVNWGRIVTMMELGGALSAEAAEAGLTCQVDDIAGWMEDSLDSPPL
RGWIQDNGGWDAFLQLYESRPPVTSWSLRTVVGLVVLGAAGITLGALFSQK
>gnl|bcl2dbpro|A0A3Q1B7Q9_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Amphiprion ocellaris (length=216 residues).
MKSSSVSRVKVEEENIQQVAANTHTQRYPLTHSLSLSLSLSLSLSLSLSEGAWPPAVFGAHPGLAPPPLQAALHTAGDKL
ARCYHGDLWAQVSVRLCRDGGGVVQRHSLTAVSRELFRDGVNWGRIVTMMELGGALSAEAAEAGLTCQVDDIAGWMEDSL
DSPPLRGWIQDNGGWDAFLQLYESRPPVTSWSLRTVVGLVVLGAAGITLGALFSQK
>gnl|bcl2dbpro|A0A3Q1BPF0_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Amphiprion ocellaris (length=231 residues).
MILYKVLGLYLLSDSSSCLRIIIATTLSNSPSVLSQVKTSSSFSDAKYQGGPSRSQNRDEALNKETRQLVKRFLGESTGL
LESSSEENEALSTMKRTVRRVLQKYRNVYDGMIEKLPVDGRGDKVTSVSAVACAVFADGAANWGRIVSLVAFGVVLCQNV
NKNERGRLTLVESVGEEISTYLLTDQKDWLLKNNSWVGFVEFFAEPRHELRDAFVFIAGFAGIIWALIYFV
>gnl|bcl2dbpro|A0A3P8TSD0_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Amphiprion percula (length=231 residues).
MILYKVLGLYLLSDSSSCLRIIIATTLSNSPSVLSQVKTSSSFSDVKYQGGPSRSQNRDEALNKETRRLVKRILGESTGL
LESSSEENEALSTMKRTVRRVLQKYRNVYDGMIEKLPVDGRGDKVTSVSAVACAVFADGAANWGRIVSLVAFGVVLCQNV
NKKERGRLTLVESVGEEISTYLLTDQKDWLLKNNSWVGFVEFFAEPRHELRDAFVFIAGFAGIIWALIYFV
>gnl|bcl2dbpro|A0A3P8UH71_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Amphiprion percula (length=212 residues).
GAMAAAYSSRDIVEDYLHDKLVSRGVAWPRPLPGRTPRRRGTADDVLLGEEAVCVDPGLAPPPLQAALCTAGDELARCYH
GDLWAQVSVRLCRDGGGVVQRHTLTAVSRELFRDGVNWGRIITMMELGGALSAEAAEAGLTCQVDDIAGWMEDSLDSPSK
LIKRFVSLISQDAFLQLYESRPPVTSWSLRTVVGLVVLGAAGITLGALFSQK
>gnl|bcl2dbpro|A0A3Q1IMG1_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Anabas testudineus (length=209 residues).
MAAAYTSRDMVEDYLRYQLLSTGVVWRTPPPQPQRARTSREGDATTDHAHTGIRLPLPRVQVALRCACDELERRYYDNLS
AQVLLLLQCRNRSGVERRQNLTRVSDELFRDGVNWGRIVTMMALGGVLSSEVARIGRVGQVDDIARWLEDSLESPRLQRW
IADNGGWDAFVELYGDSRPPGSFWSMRTMFGLAVLGAAGITLGALFSQK
>gnl|bcl2dbpro|A0A087ZQJ8_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Apis mellifera (length=300 residues).
MAGDDDASPNNEILSTDGEGQGASVRGEPHSRVGGILECDPPGNKNSPSERVCNNDDCADGSGETMIADDCNNSGGVETV
IAGDNGALCRYALSTVNTAMSFIEVCQIRLQHLFPQLISSSRYRLCEDSIELTAECLANDVIRYLLKEDIYLISRDPVSR
SMRHNVYQMLNKHSILFASMVNRLNVVPDTAYEAFMGVADELFLHGGVTWARIVCLYAFMGRLALWARDRRMHALKKKLP
LYVSRFIGEKVAHFIKGYGGWEQLCIEYPVAEEISGAIWRSLIMTGATLGLVATILTVTS
>gnl|bcl2dbpro|A0A068QLP8_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Viruses] Armadillidium vulgare iridescent virus (length=153 residues).
MDEIPKITKCVVNPSLITDKEGLRKDLAVAVLYLIKEVLKFSNKKDVNGADKLCQDLLAQTPNVNFETSVYQVFEELFAE
GISWYKIATLFAFCHILATKTTVSLVESSLRSYISDYLFKWVSENGGWNGLIILANKCSNNYCIAPDQNNEGN
>gnl|bcl2dbpro|A0A3P8Q7X1_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Astatotilapia calliptera (length=198 residues).
MAAAYSSRDLVEDFLRYKLLGRGVAWPQRRANDERAPRPDPPVAPPCLQTVLRSAGDELERLYGNELSAQVTVLQLRGNG
GGAARRRHLTAIREELFRDGVNWGRIVAMMELGGALSAAAAKSGDEGQMDDIASWMEESLDSPSLRRWIHDNGGWDAFVE
LYESRPTDSFWSLRTVCGLVVLGAVGVILGFLFSQKQN
>gnl|bcl2dbpro|A0A3B1J8Y8_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Astyanax mexicanus (length=207 residues).
KEEKLPRTERPDRGLEGLQSAKGASMGGGSLPDSPRADEDFIPDFSCRCPGFYRGYLGQKPREQSPALRTMSRVVAGVVF
KHGIAYNGMVQKLNLEEQDDSMDFISSVAKTLFSDGNHELRILSLVASVCVDMLKKEESRSLHHLYHFASLISLIFVCVC
VYNVCVFVLQEGFVEFSEVKGQNLLVKSLKAVSRVAGLGFSMFLLHW
>gnl|bcl2dbpro|A0A3B1JPB0_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Astyanax mexicanus (length=218 residues).
MANESPYDSRDIVEKYLYHKLLKRGYVWEFRPASAAASATAAAANSTSAASADDDNDDEAEPERAGPARLHRLLREAGDE
LERVYQRDFAAMWDQLRVGPSAQLQRSFVAVAEELFGDGVNWGRVVAFFEFGGTLCVESVNREMASQVEHIARWMTDYLN
GPLLQSWIQDNGGWDGFVEIYSQQRRSIFHPWPYLKTVFGLAALGAAGVTIGALFTQK
>gnl|bcl2dbpro|W5K2Q2_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Astyanax mexicanus (length=201 residues).
MASKNDMVVYDSRGIVENYLHHKLAKSGHARGEEEEEDEEEEGKRVHPAPPAVHGALREAGDELERLYRSDLTDMTGRLE
LEPAGARRSFAAVADELFRDGVNWGRIVAFLEFGAAVCVERKRTAAEGITADVARWMTEYLNGPVLRGWIRENGGWDAFV
DLYGRQKDSVFGSSWPSIVTVFSLAALGAVGFTIGAYLAQK
>gnl|bcl2dbpro|A0A158N8X4_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Atta cephalotes (length=322 residues).
MRCENGASPRKLEKTLENGSDLDGGEEWRLVGMVPCSSPVREKRMAGDDGTTTNNEILGAEGGEEEQGTSARGELHSRVG
GILECDPPGNRNSSNERPAATAAANNEDGVCRYAVGAANRAMSFFEMCQIRLQYLFPQLSPPPRYNIHDDSIESTAEILA
NDVMRYLLKEDIYLISQDPVSRSMRHNVYQMLNKHSILFTSMVNRLNVVPDTAYETFMGVANELFLHGVITWARIVCLYA
FMGRLALWARDRRMHSLKKKLPLYVSRYVGENITHFIKGYGGWEQLCVEYPVAEEVSGAVWRSLLMTGATLGLIATILSV
TS
>gnl|bcl2dbpro|A0A0C4XXZ0_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Azumapecten farreri (length=225 residues).
MATEGIQMGSNYPVKGNLFAEIHKQLGLMPGFQGLGQDMSKLDQQTQTPGSASPLEKIRHESEVIAADVISSFGLEECKK
PVDRYCKTMRRTVRELSDRHDIAFKGMVNKLNVDDSNAFPTFVSVVDEIFEDGQINWGRIVAVYTFASRLALHCRVNTPD
CDEKIALYAGKYVASKLGRWILDNGGWDAFADYFPEQGAMEDKLWKGLVYTAMGLGALATMVATR
>gnl|bcl2dbpro|A0A3Q1MEB8_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Bos taurus (length=173 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDMEENRTETPEGTESDMEIPSAINGNPSWHVADSPAVNGAIGHSRSLDARKM
IPMTTVKQAVREASNEFELRYQQTFSDLTSQLHITPGTAYQSFEQENGDWDTFVELYENNTTESQKSQESFNCWSLMDVS
VAGVVPLGLLFNS
>gnl|bcl2dbpro|A1L569_uncBCL2L2-01 Putative BCL2-like 2 protein OS=[Eukaryota] Bos taurus (length=242 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QTQVLAPAPAPAPGMASTLAQALAPGLAQAVTPPAPRTNQTGEGTLTEALLQLQFDTDEDLGALLGNNTDPAVFTDLASV
DNSEFQQLLNQGVPMGPHTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGPPGLTNGLLSGDEDFSSIADVDFSALLSQI
SS
>gnl|bcl2dbpro|Q05KI9_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Bos taurus (length=170 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNASWHLADSPAVNGATGHSRSSDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGV
VLLGSLFSRK
>gnl|bcl2dbpro|F7IT36_uncBCL2L1-03 Putative BCL2-like 1 protein OS=[Eukaryota] Callithrix jacchus (length=147 residues).
MWKRTGLRPQKGLIRRWRPPVPSMATHPGTWRTAQCFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRI
AAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|J9PBM3_uncBCL2L10-01 Putative BCL2-like 10 protein OS=[Eukaryota] Canis lupus familiaris (length=42 residues).
GDPPEPGEWEARVGQARRHLVALLCRRLTGQHRAWLEAHDGW
>gnl|bcl2dbpro|A0A452EQI5_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Capra hircus (length=169 residues).
TSLPLHSLHITLGTAYQSFEQVVCELFLDRVNWGHIVAFFSFGGALSMESTDKEMQVLVSQLTTWMATYLNGHLEPWIQE
NSGWDTFVELYRNNTATESQKGQECFNRWPLTGMTVAGLVVLNSLSFCLSVKLLISPSYLNEILAGYSNLGCRLLSFITL
SMSCHSLLA
>gnl|bcl2dbpro|A0A452EQI5_uncBCL2L1-02 Putative BCL2-like 1 protein OS=[Eukaryota] Capra hircus (length=206 residues).
NAINGNPSWHLAGSPAVNGATGHSRSLDAREVIPMATVKQALRELHITLGTAYQSFEQVVCELFLDRVNWGHIVAFFSFG
GALSMESTDKEMQVLVSQLTTWMATYLNGHLEPWIQENSGWDTFVELYRNNTATESQKGQECFNRWPLTGMTVAGLVVLN
SLSFCLSVKLLISPSYLNEILAGYSNLGCRLLSFITLSMSCHSLLA
>gnl|bcl2dbpro|A0A452FLQ5_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Capra hircus (length=142 residues).
MWKRTELRAQKGQYQIWKPQMPSMTTHLGTAYQSFEQEMYELFRDGVNWDSWPFFLLVGHCVESIDKEMQVLVSQITTWM
ATYLNDHLEPWIQENGGWNTFVKLYGNNTAAKSQKGQGRFNRWSLIGMTSAGIALLGSLFSS
>gnl|bcl2dbpro|A0A2D3E532_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Chondrosia reniformis (length=224 residues).
MANVSGELPSSGQAPKLTLNDTSNLSALIVVTFLKDILEEHYYEGLVKGITDQKRFRELTERENIRNMVQKVTGKLKAIM
AKFPESNVTSVRQRCSRLDIHQANASAKYHVTAQHLFHDGITWGRLALFYSFTASFCVYVAESQMEDLVDSTIEWCLALQ
HSRLDPWILQSHGWDGFVEYADKALGEKPRVNEDDETHFHFSGKLVAAAAVIGAAALASFFGSR
>gnl|bcl2dbpro|A0A2K5HYN7_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Colobus angolensis palliatus (length=71 residues).
MARSRLTATSVSQVQENGFVKKLEPKSGWMTFLEITGKISILLTRKDTPYCETGLIFLTLKKTIANTYFTF
>gnl|bcl2dbpro|K1PS96_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Crassostrea gigas (length=799 residues).
MPPPSEQEIKAEVRKILEQFLKKQLLNNNEEESAIPTGFQRVSVEDVVETDGPGSTSTSREGSRYSSKTSCARCRSEASQ
SIPTSSIRSLTDNTIDFPFIDEDENEVDHSDKDHSERSKSLPSNILSSVKIQDKNSLALSKSLSPTKLREVINNGPPLNK
ASEKGDRELSLYSSEDFLQTGSGLKDIEEIGISRGRQRLKSGTESGTDDTDYEEEVISPNRKKKSIFTRLKERMNRSLSR
GRIKENEENKRTRSRSEGSVIIKRRKPRKKKDIGSSVDKVSDVVQNVHTHKHGHVEQHHYSNGNKSGMLMESEVWESTDV
TGESEHKHEERHSNIRESKEQPSDGENGIMRRLKKMTSFKKSKKNKSDSPSSKASKSDEVDFDHKRPKSPKTDFGRSVSS
GQGYQERVHMNGDHSRQTTTTTVVTGTQIQGCTDENLPEGPIKGEVMDLAKKNKSFVLDFETCERQQRRLLPDGSFDTTV
QQHVKVKHFDEGHDIEVDGTEDQAMCPRHAASGQPNPEKDRLYTAVAEKLAHIGDHYMATSPLSDSTSSSVDHTATRRVS
ARTPNLPGVDERDSDGLTQLERQLRDKFREVGDTFSLDISPDSVKDAAMEIAKQATYQKFQEVVDNKIGPGNSWDQIAAV
FYLTKKAVTLAGVGGAVALQVKDLAAEYVADKFATWIVDQGGWGKHLSVLAPPELNENITVKINFSKCYNVRGTQQILHM
EQGPRSKILEVFRINTYSNSPGTNRNCLWMGGGFTIDNHTTVTFSSSRGRPIPDSVCRSTSFTDFPDEYLHIRLQELSR
>gnl|bcl2dbpro|K1PWI6_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Crassostrea gigas (length=146 residues).
MDRLGTRYIVTDYLNHRLSKNGHTWTHCPPLLDPPLKIHTTMRDKGDEFEELYKVQFQDLVDQLHVTHDTCYPMFKAVVE
ELFQGGTNWGRVVALFAFSGSLATRCVEKGMAGLVDSIVDWVTQFIEQDLRQWIDQHGGWVGYHRE
>gnl|bcl2dbpro|K1QHH5_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Crassostrea gigas (length=227 residues).
MATEIENIKHSSGNYLKGNLFSEINRQLGILPGFAGLGQDMTKLDQETQTPGSTTPMDKVRQTAEVIASDVIATFEDDST
KTPQNRYCKTMRRTVKEMSDRHNIAFKSMVQKLNVNDTNAFSTFVSVADEIFEDGTINWGRIVAVYTFASRLAAHCKKHN
PESEERIALYAGKYVASKLGKWILDNGGWDAFSDYFPEQGATEDKLWKGLMFTAVGLVTLGTMVARS
>gnl|bcl2dbpro|K1R9D6_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Crassostrea gigas (length=205 residues).
MATELENIKHSNGTYLKGNLFSEINRQLGILPGFAGLGQDMTKLDQETQTPGSTTPMDKVRQTAEVIASDVIATFEDDST
KTPQNRYCKTMRRTVKEMSDRHNFAFKSMVQKLNVNDTNAFSTFVSVADEIFEDGTINWGRIVAVYTFASRLAADCKKHN
PESEERIALYAGKYVASKLGKWILDNGGWVSIDLNVNCNLKRSLV
>gnl|bcl2dbpro|A0A3P8W0Y8_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cynoglossus semilaevis (length=190 residues).
MPSNGQWVSMGKARNSGDQARRSQRWDQALNKETRQLMKQFLGESMGLLKCSREESEALSTMKRVTARLLEKYGNAYNGM
IGNLPVDDRGDKVISTGAVARAIFADGTTNWGHIVSLVALGVVVCRHYNEKEEGLDFVESVGDEISTYLMTEEGLADGFV
KFFAEPKRISTLGFCVRVATIGLLISLTAI
>gnl|bcl2dbpro|A0A3Q2DJ96_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Cyprinodon variegatus (length=227 residues).
MANDCNRNIVENYIFHKLSKRGYVWEFNGEDGAADNGGLGDHSPTLVRRCRDAGAGPQSDSDPRRLCRRLSGSDPRADIH
RVLRDAGDELERLYQLDFVEMSQQLYLTRDTARTRFAEVIDELFRDGVNWGRIIAFFEFGSTVCVECASKEEMLSQVDNI
AEWMTEYLNGTLDSWIQDNGGWEAFVELYDRQKESILSCYWPSIKTVFGLAALGAASITIGAYLAQK
>gnl|bcl2dbpro|A0A3Q2G0M1_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Cyprinodon variegatus (length=202 residues).
MAAYSSRDIIEGYLRCKLLDGGVAWRFPKQRHFQFPWRSEEGGAPGPLQLALPRLLAALRNASDELEGRYGSSLHGQVAA
LRHRELGGAAARQSLALIRDELFRDGVNWGRIVAMMALGGALSAQAARTGETGQVDDIADWMEESLEAAALRTWIHDNGG
WEAFVEMYECRPPDTFWSLRTVFGMVVLGAAFITLGLLLAQR
>gnl|bcl2dbpro|B2L8N7_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyprinus carpio (length=230 residues).
MALSLDFRRWAAGSRFQRSAAGIWLLTSCWCVLQRLRTCALVALCWPRPGTNGLKGLQLDGLVRVRGGTGSLPATPPYWE
FPLSMPARDVEQPVLLFRDQIAGMCPVDRKLHHAIPTMKRVVDNILVKHQIAYKGMIQRLQLDSQPASLDFIRCIASTMF
KDGVTNWGRIASLVAFGAVVCSRLKELQQDQCVERVAEQISSYLTSVVRHGLLALVGCAGIGAGLAFLIR
>gnl|bcl2dbpro|F8W266_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Danio rerio (length=209 residues).
MAQENVYNNRSIVENYIHHKLWKKGYVWEVNGHDSVSNGLSMGRQENSVVSPSSRHDPYSALHNVLREAGDELESLYQSD
FAEMSKQLHVTSITAHQRFNAVIDELFRDGVNWGRIIAFFEFGGTVCAECVNKEMTGQVDNIAVWMADYLNGPLHGWIRE
NGGWEAFVELYSSQRDSVFHSSWSSIVTVFGLAALGAVGLTIGAYLAQQ
>gnl|bcl2dbpro|A0A0P5E6Z1_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Daphnia magna (length=193 residues).
MKKTMASTTWLTSNNTTQPTREFVFEQNSTFAINIVKEALGEKVDLSKDKIYRTLSTCVGEVLANCESPMQQLVNRLDLS
RGIGHDKFATLADELFEAENGFIVLWERIVTLFAFTWVLSKQLHTDPVVSSSNISKILASYLNDKITPWILQEGGWIKIC
NEFGDDAAASNKWKYFFLTGLGIGLVATYKLTH
>gnl|bcl2dbpro|E9FUS6_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Daphnia pulex (length=189 residues).
MASTNWLTSKNTSQSTRESVLEQNSTFAINIVKEALGEKIDLSKDTIYRTLSTCVGEVLANCESPMQQLVNRLDLSRGVG
HDKFASLADELFEAENGYNILWERIVTLFAFTWVLSKQLHSDQIESSNNLSKILASYLNDKITPWILQQGGWIKICSEFG
EDTSASNKWKYFFLTGLGIGLVATYKLTH
>gnl|bcl2dbpro|A0A3P8ZG74_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Esox lucius (length=148 residues).
MMMTYVRCLLSPNLGFVNEWPVDTLNCLDGISKGDGCFCGVCGLWCSGSKALSTMKQVVTKSLDKHRYSYNDTQRGMRFG
SVVANTDRVVSLLAFGAVGQEISIYLLTDQKDWLVKNNSWDRFIEFFRLAEESTLRNVLITFDLYNVK
>gnl|bcl2dbpro|A0A3P8ZH18_uncBCL2L10-02 Putative BCL2-like 10 protein OS=[Eukaryota] Esox lucius (length=222 residues).
MPLMTAALLLPAVRRESSLIAGRIMSCGLWKETLAVAEDYLSVCRIVPTPGSPAATPPPPPSESAAAMRHLALDMEAQHR
ARFHALAHSFLSQCGLDPCASLRRVMEELVGDGQMNWGRVVSLFTFTGVLVRKLQGEDTDQGTGVRGTEWLGGKESCRAL
AETIANYLGKEKSDWMLKNQGWEGFCKFFHSARVVNQDSSMKTALFAAAGVGIAGLTFLLVR
>gnl|bcl2dbpro|A0A3P8ZH18_uncBCL2L10-01 Putative BCL2-like 10 protein OS=[Eukaryota] Esox lucius (length=292 residues).
MPLMTAALLLPAVRRESSLIAGRIMSCGLWKETLAVAEDYLSVCRIVPTPGSPAATPPPPPSESAAAMRHLALDMEAQHR
ARFHALAHSFLSQCGLDPCASLRRVMEELVGDGQMNWGRVVSLFTFTGVLVRKLQGEDTDQGTGVRGTEWLGGKESCRAL
AETIANYLGKEKSDWMLKNQGWEGFCKFFHSARVVNQDSSMKTALFAAAGVGIAGNLLRRPWVPVTVASGTFCLMADARS
WKRDRYPHPPLRPQQTHTQCYTGCRYVCKINNFALDYSISYILYVHAFIYFF
>gnl|bcl2dbpro|A0A0M4MPT9_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Viruses] Felis catus gammaherpesvirus 1 (length=189 residues).
MEQNQDEHADVLAAFIGEFYGFYGLPFSGDFGSTECHVVGLVLADVAYQATTQLQGFEHLFQQMLQMDLDEAVILFQEVA
QELFTEINCGRIIIFLSFSGLLLVKCVTQRKILLERCLHTSILTLLRGVLGNWLEQNGGYDALLNNLVQNHPLVDLTTSP
SYRFLTYFFIFLCGAAVAALFSILLMKIR
>gnl|bcl2dbpro|A0A3Q2PBH5_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Fundulus heteroclitus (length=190 residues).
MAGYSSRDVTEGFLRHKLLDRGVAWRFPPPPSQPDVASPVPQRPEEGAGPDRLPLARLLAALQGASDELEGRYHSELHGQ
VVALQQQDVSGAATCRSLELVREVLFRDGVNWGRIVALMTLGGALSTEAAQTGQTGQVDRIAAWMEESLETLQGWIQDNG
GWVGVHDHLRSTWACFCALIGCEQMQLASV
>gnl|bcl2dbpro|G3PJ83_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Gasterosteus aculeatus (length=182 residues).
MSNECNRHIVEKYICHKLSKRGYAFGFDDVGEEDAASNGSMVVPPPTAVRRCREAGPDGESFPRLCKRLPQSDPTAAATH
RVLREAGDELERLYQPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCAECVAKEEMASQVDNI
AEWMTEYLNGPLNIWIQDNGGW
>gnl|bcl2dbpro|G3PW08_uncBCL2L10-01 Putative BCL2-like 10 protein OS=[Eukaryota] Gasterosteus aculeatus (length=200 residues).
QSDIAGRKMSCGLWKETLALAEDYLYLCCSSPRPAPPPPSGSAAAMRLLAWDMETQHQARFHALAQTFLRQCGPDPCSSL
RQVMEELVGDGHLNWGRVVSLFAFTGVLARQLLEQKATKLGLDPGQELGQEPGSCRGLAETIADYLGEEKKDWLLENDGW
EGFCKFSRSAREVGHDSSMKKALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|Q967D2_uncBCL2L2-01 Putative BCL2-like 2 protein OS=[Eukaryota] Geodia cydonium (length=235 residues).
MAARGSAAPGGRANGRFHSRLYLQNTAVMEELYRRNLSEDLVRDNGLSCGGREYWREPASTVGAASDGLSEEERRTAADA
AERMTAVIAGTPGIAVERNVRDFRRGGWDVTPDNVESEFREVERRTFSDGVHWGRVIAFLAFSMSFAAYVNSRGIDGGAY
SVFNWTLRVLNDSLADFIQRENGWRGFIVYADTLLRAQGSTPPQHQTRGVWDAVAGIGVIGVGTLLALGMRQAFS
>gnl|bcl2dbpro|G3R922_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Gorilla gorilla gorilla (length=79 residues).
MARSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICEMLFCPEAILLTRKDTPYCETGLIFLTLMKTIANTYFYF
>gnl|bcl2dbpro|A0A3Q2V6F4_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Haplochromis burtoni (length=228 residues).
MASNSRDLDEMPQPRTSDRVVRPCWLNIDASGPRVIVSDGLSQSVQHLNDPPTFGSGWLADATGMIHIAGSYDTYKCVDC
NIVLSGYKKADRSLNEHVLLPTITRVARTLFSDGIINWGRIVSLVAYGTVLLQASKSTLGPECAYAIGVSIAAYITDNHM
DWLAGTDGWVCSFFTVFFRPFCLVDTFKLAWHGLRGPGMTSLGILHTQRALRSNTPKTQGGVLVGMCV
>gnl|bcl2dbpro|A0A3Q3CNF3_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Haplochromis burtoni (length=198 residues).
MAAAYSSRDLVEDFLRYKLLGRGVAWPQRRANDERAPHPDPPVAPPCLQTVLRSAGDELERLYGNELSAQVTVLQLRGNG
GGAARRRHLTAIREELFRDGVNWGRIVAMMELGGALSTAAAKSGDEGQMDDIASWMEESLDSPLLRRWIHDNGGWDAFVE
LYESRPTDSFWSLRTVCGLVVLGAVGVILGFLFSQKQN
>gnl|bcl2dbpro|A0A3Q3CSD9_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Haplochromis burtoni (length=226 residues).
MCQMIHWYDWQERSWHLISLALQRRSRVEMQCRNRELVEFFISYKLSQKNHPTSLLRPTNVGQRTERDLAKSLPAYDGIE
ALKSALLDSGEQFGFLFTQSFRDVASHLNITPDTAQQCFESVMEELFRDGINWGRIIGLFVFGSAMCLDCIDSNMGELVP
DIADWMTAYLDDHISLWIQRNGGWDRFTEIFGKGMSTRSSGESLKRWLFVGVALVTGLLVGMLMTD
>gnl|bcl2dbpro|T1EKX5_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Helobdella robusta (length=92 residues).
QKTFRNMIKSLDISSVNSARLSLRRVFEEVFSDRNCNWGRIVTIVAFSVEVSRFGQKLNNEDSKHFPEKISEFVSEYINE
YLSTWIVSQGGW
>gnl|bcl2dbpro|T1EKZ7_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Helobdella robusta (length=71 residues).
RVLKEMFSDGHTNWGRIATLFAFGAALCKYSLENNKQELIEPITDSIALYISTNKSNWIRQQNGWVGFFLF
>gnl|bcl2dbpro|T1FMT5_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Helobdella robusta (length=190 residues).
MSSLEATNKILAADYIYFKLRKSRFDWPVRCPVDLKKDGGCAEAKLAMRNLGEEFEERYRGVFNDMCQQLHITPNNASAT
FRAIIGELFSDGIRWGRIVALFSFSGCLAVECMERKMPHLVDEVLTWTTAYLDEHLSKWIQDNNGWDGFVEFSKGGQTKE
SPWPSFKTLCGYAVGALGVLTLGAILSQRS
>gnl|bcl2dbpro|T1FPP3_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Helobdella robusta (length=328 residues).
MGDIFISEENEKLLGGREDDVVAVGGNYNDDDDSISDITTTTTTTTTTTTTTTTTTTTTVATTTTIATNSINNNNAYNNG
DNNNNTNNSDSSSSTTRNRSSTHQRQNHANHQRRHRRHQTSSDDAAARDLFYLNDRFITEEFRNKCAEVAYDIVTYVCHS
GPYQPYPPPSKTTRLMRNLVNDLAKNRGELMDDMASQIVLNAKSMEQLEILLNELASEMFNDNVITWNRIVMYHAFCAYV
AKFCKLHESIEDIEEVVVRILVDIVVNRLGLWIATCGGWAQFDSQFPMLCCILQSGCIWKVLLLVCAFIGTIVIFYKAIH
FLDSSRKI
>gnl|bcl2dbpro|A0A3Q2XQV3_uncBCL2-02 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Hippocampus comes (length=202 residues).
MDYSRRSFFFSSQRRIILHEDEQGEEDDAAAANNGLLVAPSPTLVHGSDPLADIHRVLREAGDELERLYQPDFTEMSRQL
YLSSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECATKEDMTSQVDNIAEWMTEYLNGPLGSWIQDNGGWVSV
IRCTVVFFFSLVMKWPVAWVVLTFTALAHNFYGLTVNIQHSS
>gnl|bcl2dbpro|A0A3Q2XQV3_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Hippocampus comes (length=221 residues).
MDYSRRSFFFSSQRRIILHEDEQGEEDDAAAANNGLLVAPSPTLVLRCREASSGPERDCAPKRSHGSDPLADIHRVLREA
GDELERLYQPDFTEMSRQLYLSSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECATKEDMTSQVDNIAEWMTE
YLNGPLGSWIQDNGGWVSVIRCTVVFFFSLVMKWPVAWVVLTFTALAHNFYGLTVNIQHSS
>gnl|bcl2dbpro|A0A3Q2YEL9_uncBCL2L10-01 Putative BCL2-like 10 protein OS=[Eukaryota] Hippocampus comes (length=200 residues).
MSSCGLWNESLAIAEDYIGLCLTADPSEAPLPPSEAAATMRRMGRHAESLYEATFQNLVQTFVRGCWPDLCSGLRRVMQE
MVSDGFLNWGRVVSVFAFTGVLARRLLEDNEEEETTTTTTKLRLDLSDWPQICRKLAETIADFLIEEKKEWMLENNGWEG
FCKWCSSSSSRQSSQDAYLKTALLAAAGVGLAGLTFLLAR
>gnl|bcl2dbpro|A0A3Q2YME0_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Hippocampus comes (length=225 residues).
MANERNRTIVENYICHKLSKRGYAWGFGAEDDAAAANNGLLVAPSPTLVLRCREASSGPERDCAPKRSHGSDPLADIHRV
LREAGDELERLYQPDFTEMSRQLYLSSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECATKEDMTSQVDNIAE
WMTEYLNGPLGSWIQDNGGWDAFVELYDRQRDSVFSCTWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A3Q2YME0_uncBCL2-02 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Hippocampus comes (length=193 residues).
MANERNRTIVENYICHKLSKRGYAWGFGAGEEDDRSHGSDPLADIHRVLREAGDELERLYQPDFTEMSRQLYLSSTTAQR
RFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECATKEDMTSQVDNIAEWMTEYLNGPLGSWIQDNGGWDAFVELYDRQRD
SVFSCTWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A3Q2YX57_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Hippocampus comes (length=233 residues).
MPESIRLQIFKIGLVDAFISPPKTVVQESTAPQLQEMELRSDNSDMDEGAQPLPELQTPPGQGILDSDTRRLISRFLSDF
TGLSTAAWIQSKAQSTMKRVVMRLVDKHRILFNNSINELSLDEIGLDIVSQVPQTEFANGNINWGRIASLLAFCAVLSQA
LKENQQESCVELVAQEVSTYLLSHQRTWLVQHNGWDGFAEFFKEDDLESSVRNVLLGFVGLVSITAALRCLIR
>gnl|bcl2dbpro|Q9HBF5_uncBCL2A1-02 Putative BCL2-related protein A1 protein OS=[Eukaryota] Homo sapiens (length=79 residues).
MARSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICEMLFCPEAILLTRKDTPYCETGLIFLTLTKTIANTYFYF
>gnl|bcl2dbpro|Q9HBF5_uncBCL2A1-03 Putative BCL2-related protein A1 protein OS=[Eukaryota] Homo sapiens (length=79 residues).
MARSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICEMLFCPEAILLTRKDTPYCETGLIFLTLTKTIANTYFYF
>gnl|bcl2dbpro|Q9HBF5_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Homo sapiens (length=79 residues).
MARSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICEMLFCPEAILLTRKDTPYCETGLIFLTLTKTIANTYFYF
>gnl|bcl2dbpro|A1E3K7_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Hydra vulgaris (length=178 residues).
MSDTPINFNTPEAKIAKEVAYQLIQKKTGKNIKNQQIRKETELMMRLVEEIEIKHELFLSNMCKRLNLNTENAQSMFHTI
AEEIFSDGINWGRIIVLYAFAGKIAEHCRKSNDEQIIDKIALWVAGFVAKKSSWIRDSGRGWNGFIENFDVKQDSWVQGL
FAATLGLGTIAAALYIKS
>gnl|bcl2dbpro|A7LM79_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Hydra vulgaris (length=205 residues).
MTTNSFSNVLCNLETPCNKNVEPCDKKNIENTLNNEIKLSKTYIDSLLVATYVVKKRIGIQQKYNKIGEKVFELCLELVS
KHETFFNNLTNELNISRDNIKEVIKIVLRNVLKDSINFGRITSILAVCMIVSEHCYKNESMSDKVCLIVETTAEIIYENR
KWFEANGAWDGLMKYFFNPTDYFWKGFVVTTVGLGAMAGLLYAKS
>gnl|bcl2dbpro|A7LM80_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Hydra vulgaris (length=192 residues).
MAGPPNAQEDNYKRIVKSYVGEKLRKKGLKIRGYEGEELKPPVIEIAKTLQRVGDELESANTDFFKNMCDQLQITPSTAY
PTFQSIADEIFVSGKNWGRVVAFLTFGGNFAVHCALRADMGEEYVDRVVNWISKYMAVNLDYWINQQGGWDGFLIFFEKT
KNNDDEQGSQSVFLVSALAGLGVGALLMLTFK
>gnl|bcl2dbpro|B7Q4U7_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Ixodes scapularis (length=285 residues).
MAVNETDKTQVSEMVNDFLRYQLNRRDLQWTTCPPLPRPSKVVLVLRTLGDEFLAKYRDEFVQMCGRLDLTPSVAQTAFL
DVLNELFSEGITWSRVVGAFAFSFELSAHCVEKNWSDLVDGIASWLSSYVCTRLLPWIQDHGGWVSDPPTRIPSPRASAA
FHDAGFRRGGRRFSLSQFLLPRPTVSLPLNGGLSCRSLPPLPARSAYLGDANSPHSLKPAPVCSHTEVWADAEPPQAPKS
GARSTRRSGCDAARTLIEPKPLEKIKTAECGVHLVVPSGSFIPRD
>gnl|bcl2dbpro|A0A3Q2ZTM7_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Kryptolebias marmoratus (length=209 residues).
MPDSYSSHDVVEGFLCYNLLSGGMAWRFYRDVSALLPWRSEPAMVTHGGVAPGYLQQAPPRLLAALQSACHELEGRYQGD
LYAQVVALQRGEGGGAVWRWRLKTVTDELFRDGMNWGRVVVMMALGGALSREAVRTGETDQVDVIADWLEESLDSPRLRR
WMGDNGGWDAFVELYESRPAVPFWTPRTVFGLVALGAAFITLGVLLTQR
>gnl|bcl2dbpro|A0A3Q3GG85_uncBCL2L10-01 Putative BCL2-like 10 protein OS=[Eukaryota] Kryptolebias marmoratus (length=197 residues).
MSCGLWKETLAVAEDYLSLHCPSPCPGSPPPSDTAAAAAAAMRRLGQAMEAQHQARFHSLAQNFLRHCGPDLCSGLRKVM
DEMAGDGHFNWGRVVSLFTFTGVLLRQLQEQQRGSKPGLDPGQPQELEPVSCRALAKTIADYLEEHKKDWLLENNGWEGF
CQYSRKATEASQDSSMKTALVAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3Q3GJH9_uncBCL2-02 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Labrus bergylta (length=189 residues).
MTSHRDFHPGEEVYCVVMVTFIEAITSRLLTSPSPSSPAAFCPHHQSEGSGQVGGALKRHACDDLARRYHGDLAANLSAL
SQQDGVEAAGLGGLTAVREELFRDGVNWGRIVAMMEVGGAVCSEAVKTGGAQQVEVIAGWMEEGLDSLQGWIDDNGGWVG
GLLFPLPPRHHQRAGDCSSVLDAPIGQFE
>gnl|bcl2dbpro|A0A3Q3GJH9_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Labrus bergylta (length=194 residues).
MSALYNSRDIVEDFLRHRLQQDGRVTLPPRRHHAALRSTSTSSLTWRAVRVMTSHRDFHPDLTAVLRSACDDLARRYHGD
LAANLSALSQQDGVEAAGLGGLTAVREELFRDGVNWGRIVAMMEVGGAVCSEAVKTGGAQQVEVIAGWMEEGLDSLQGWI
DDNGGWVGGLLFPLPPRHHQRAGDCSSVLGFNYL
>gnl|bcl2dbpro|V3ZZU7_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Lottia gigantea (length=232 residues).
MSTTGMDSNLYASKVSNMIVNKSLFAELSKQYRSLPGAAGLNDIGNVDECTQTPGSSSPLEQVRRDAEVIANDVVLTFGA
DETKKATNKYCKTMRRTVKEISERHDISFKGMVNKLKVEESGRTFETFVNVADEIFDDGQINWGRIVAVYAFAARLANYC
RQKDLNDCPEKVSLYAGKYVGSKLGKWILDHGGWDAFVEFFPDHGEFEEKVWKGLLFTAVGLGALATVVASR
>gnl|bcl2dbpro|V4B1H3_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Lottia gigantea (length=186 residues).
MDDELSRNIVQDYVSYRLRKNGHRWQNGPMIEGGPSRICLTMRSLADEFEDRYRSQFEDMVNQLEITPGIAYQTFRSVVS
ELFSDGVNWGRIVALFTFGGSICVQCVENNMPHVVDNVVDWVTTYCDNDLKPWIDSHNSWQGFVAFYDREPERRNDSPWT
SFRKICGFAAGAIGVLTLGAILTQKS
>gnl|bcl2dbpro|Q1RPT4_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Lubomirskia baicalensis (length=184 residues).
MTAVDGKSETLFREQTRTIVRASLRSYSTTKGDDTATFVATCVADIRTCNHDEFDQMCLQLDASPTSVQPRVVQIFRETF
NDGINWGRIVAFLAFMSHFSADCEKKQLYGSVESICEWSVDLITSHLENWIRAEGGWVAIKKAIDVKTKQQQSQQQQFFG
ANNFMSFVNRGLKAAYRAAVASVY
>gnl|bcl2dbpro|A0A2K5WP17_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Macaca fascicularis (length=78 residues).
TAQSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICETLSSEAILLTRKDTPYCETGLIFLTLKKTIANTYFYF
>gnl|bcl2dbpro|F7E8W0_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Macaca mulatta (length=59 residues).
VVQENGFVKKLEPKSGWMTFLEVTGKISILLTRKDTPYCETGLIFLTLKKTIANTYFYF
>gnl|bcl2dbpro|A0A2K6AUD8_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Macaca nemestrina (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K6AUD8_uncBCL2L1-02 Putative BCL2-like 1 protein OS=[Eukaryota] Macaca nemestrina (length=145 residues).
MWKRTGLRPQKGLNRRWRPPVPSMATHPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAA
WMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K6E2M6_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Macaca nemestrina (length=78 residues).
TAQSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICETLSSEAILLTRKDTPYCETGLIFLTLMKTIANTYFYF
>gnl|bcl2dbpro|A0A223FZ28_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Macrobrachium olfersii (length=306 residues).
MAPVTDKIVPKRTNDDESDEGFVSPSVDRVGLRNHKDTIRQSESESGNSSSDNDSQAGSSSSTTTSSESSQALQNSDEEM
EENTAAATGTTHSDNKNSKDEEAAHAKGTTNSDSQTAVTPSAPPAAVVAKDPAAESKAESLAKFVVYTLLEKHNGDSSDK
VERTLLRCVKMMMQKHEILFKGMMKRVQVTRETGYISFVTVANTLFEEDKMVITWSRIVALYAFGGQLALYCKEKGMEDF
ACTVADFMGKYAKEVLTPFVTNIGGWSKICDEFPEETDLENRVRRVLSWTAVGLGVAATVSYLTSR
>gnl|bcl2dbpro|A0A2K5YIF7_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Mandrillus leucophaeus (length=78 residues).
MARSWLTATSVCQVQENGFVKKLEPKSGWMTFLEVTGKICEMLSSEAILLTRKDTPYCETGLIFLTLKKTIANTYFYF
>gnl|bcl2dbpro|A0A3P9BV81_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Maylandia zebra (length=226 residues).
MCQMIHWYDWQERSWHLISLALQRRSRVEMQCRNRELVEFFISYKLSQKNHPTSLLRPTNVGQRTERDLAKSLPAYDGIE
ALKSALLDSGEQFGFLFTQSFRDVASHLNITPDTAQQCFESVMDELFRDGINWGRIIGLFVFGSAMCLDCIDSNMGELVP
DIADWMTAYLDDHISLWIQRNGGWDRFTEIFGKGMSTRSSGESLKRWLFVGVALVTGLLVGMLMTD
>gnl|bcl2dbpro|A0A3P9CX04_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Maylandia zebra (length=198 residues).
MAAAYSSRDLVEDFLRYKLLGRGVAWPQRRANDERAPRPDPPVAPPCLQTVLRSAGDELERLYGNELSAQVTVLQLRGNG
GGAARRRHLTAIREELFRDGVNWGRIVAMMELGGALSAAAAKSGDEGQMDDIASWMEESLDSPSLRRWIHDNGGWDAFVE
LYESRPTDSFWSLRTVCGLVVLGAVGVILGFLFSQKQN
>gnl|bcl2dbpro|A0A3Q3X971_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Mola mola (length=207 residues).
MAKEYNRDLVEIYLCHKLSKCGYVWRSDDVRDENATNNGSIVAPPATLAQRCREPRAAIHRVLREAGDELERLYAPDFTE
MSRQLYLTSSTAQGRFAEVIDELFRDGVNWGRIIAFFEFGGAVCAECASKEEMSPQVDNIAEWMTEYLNGPLNSWIQDNG
GWDAFVELYDRQRDSVLSCSWPSFKTVFGMAALGAASLTIGAYLAQK
>gnl|bcl2dbpro|A0A3Q4BUL3_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Mola mola (length=228 residues).
MEKTETHLTPGLYLFQLPSVKKHLHLLVSTTNYNDAANNNKCEMWNLTGVVSHQLSERRKPKRSNIPPLKQNCNPAPPRL
QAVLRSATDELEQRYAGELAAHVSLLLLRDGGGPERRRGLTAVTEELFEDGVNWGRIVAMMELGGVLCTEVVRRGGAWQL
DDVAKWMEDSLESPRLREWMQENGGWDAFVELYGESRPAVRFWSLRTVFGLAVLGAAGITLGALISWR
>gnl|bcl2dbpro|F7CVK3_uncBCL2L2-01 Putative BCL2-like 2 protein OS=[Eukaryota] Monodelphis domestica (length=140 residues).
MASPVSTDVPALAADFVHYKLKQKTYDNLLGLEENFFAGVPSREPLHLAMHSSGDQYEFFCNNTTIDLDHAMKYFNHAAD
EIFEQGITRGYIVGFFYFSVAFGSCCIGSTKSSPIQLVKNWMVIYIETKLMNWIHQNGTY
>gnl|bcl2dbpro|A0A3Q3QYY1_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Monopterus albus (length=147 residues).
MWRLQRILLAARICRFRLGFLIWTLYFKGMIATLSSHDGGSVVRSIGLVAGSIFADGTANWGRVASLVAFGATVCRYLKE
RGGEDCTEQMGEEISAYLLTDQKEWLIKNDSWDGFVTFFANSESTLRRNILVTFVGIGVITLALLIV
>gnl|bcl2dbpro|A0A109QG17_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Viruses] Myotis gammaherpesvirus 8 (length=177 residues).
MAHAGRTEYDNREIVMKYIHYKLASAGLGGDAARMPLSAATGGDETDAPDPLQEALQVTGTGIGLVFAHRSGAGLGDCLQ
FNEENAQTTFLQVVDELFRDGVNWGRIVAFFEFGGVMCVESVNRGIPSLVDNIAAWMTDQLGGEVGLWIQENGGWHTFEH
MINPPPERHRNRRCNIL
>gnl|bcl2dbpro|A7S109_uncBCL2L2-01 Putative BCL2-like 2 protein OS=[Eukaryota] Nematostella vectensis (length=142 residues).
MVKDFIGYKLRQNNIFLEGFNMESPTKASKHLRIVADELIADNSELFHSMCDQLHLTPISTYPTFVGIANEIFQSGKNWG
RVVAFLAFGATLAVYCAQREELHELVNDIVEWVSRYMDQNLSCWIRENGGWVRFQQVFLALK
>gnl|bcl2dbpro|A7S9S4_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Nematostella vectensis (length=163 residues).
MAALQAQRKPCSETLETLNRQAHFLAQDLISYRTGNGRISTSLTARNMRRLSDELEERHGPLLCNMCNSLNMTANSAHEK
FVQVADEVFKDGINWGRIVAVFTFGGRLAQFCARNGLHDGVREVEAWLGDYIANLSHWIQTQGGWVCTFETSQSHDSANF
ARF
>gnl|bcl2dbpro|A7SFS9_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Nematostella vectensis (length=180 residues).
MEYPRNDPRQSYPELVHQAQLLAKDLISYRLGKNPKPPNANAETLRKLADKIEEQYPALLNHLCHKLNISRSTAYSTFVE
IAGEVFADGVNWGRIVVLYAFGGRLAVYCEQHNMKDLVQSVTDWVGKYIAGLSEWIANEGGWDGLKEQFRDNNTNDTTWW
KGVFITTLGIGTLAALVYTR
>gnl|bcl2dbpro|A7SPR2_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Nematostella vectensis (length=188 residues).
MPPIEGYDNANAVAARKMKTPEEKIAHELAKDFIGYKLGKGTRLNTKSALILRKLSNQIENKHELFLRNMCDRLDIRQHN
APETFKQVADEIFGDGINWGRIVVLYTFAGKVAKYCQENQLDNAENVATWVGNYVASKSDWVKKAGGWEAFNEQFKDVQE
EHEKFWWNSLLCTTLGLGSLAAVLYMKS
>gnl|bcl2dbpro|A0A3Q4H341_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Neolamprologus brichardi (length=198 residues).
MAAAYSSRDLVEDFLRYKLLGRGVAWPQRRANDERAPRPDPPVAPPCLQAVLRSAGDELERLYGDELSAQVTVLRLRGNG
GGAARRRHLTAIREELFRDGVNWGRIVAMMELGGALSAAAAKSGDEGQMDDIASWMEESLDSPSLRRWIHDNGGWDAFVE
LYESRPTDSFWSLRTVCGLVVLGAVGVILGFLFSQKQN
>gnl|bcl2dbpro|A0A3Q4HDS7_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Neolamprologus brichardi (length=122 residues).
MHVHTGMLSLQTTATEVPMVTGVVRTLFSDGIINWGRVVSLVAYGTVLLQASKSTLGPECAYGIGVSIAAYITDNHMDWL
VGTDGWDGFVDTFDRVHQRLWLSMQGKLLLLGVGLGLLSVLL
>gnl|bcl2dbpro|A0A3Q4HE32_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Neolamprologus brichardi (length=224 residues).
MANEYNRNIVEKYICHKLSKRGYVWGFRVVQEEDAANNGSITDPPPTLVHRCREASTGPDGESNTHLCRRLPQSDPHAGI
HRVLREAGDELERLYQPDFTEMSRQLHLTSATAQRRFADVIDELFRDGVNWGRIIAFFEFGGTVCVECASNEGMSSQVDN
IADWMTEYLNGPLNSWIQDNGGWVCLIPNISYRRGLLQAAALSIGPTRTFFFQQSLRYLHLKDV
>gnl|bcl2dbpro|A0A3Q4N9S0_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Neolamprologus brichardi (length=226 residues).
MCQMIHRYDWQERSWHLISLALQRRSRVKMQCSNRELVEFFISYKLSQKNHPTSLLRPTNGGQRTERDLAKSLPAYNGIE
VLKSALLDSGEQFGFLFTQSFRDVASHLCITPDTAQQCFKSVMEELFRDGINWGRIIGLFVFGSAMCLDCIDSNMSELVP
DIADWMTAYLDDHISLWIQRNGGWDRFTEIFGKGMSTRSSGESLKRWLFVGVALVTGLLVGMLMTD
>gnl|bcl2dbpro|A0A0L8G405_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Octopus bimaculoides (length=212 residues).
MGSSSNNNSEMNVPVSRYLLEDYVNYRLRRQGFTWENCPCFDRRPSKVAISMRAMADEFEERYHDQFSNMCQQLHITQHT
AYCTFQAVINELFSDQTINWGRIVALFSFSGALSLQSVEKEMPYLVDNIVEWAHTYLTDNLNTWINAHGGWEDKDKIESL
DKLKILCLVHAGSYFMLNHPTQIRLEPGAAAGSPGLSQTVQPMPAWKAVVKR
>gnl|bcl2dbpro|A0A0L8HGC1_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Octopus bimaculoides (length=206 residues).
MVSVLTNIFCSINSSPVMHPLQSVIRMDKEENLKSCRKEVPRMVKDMVLNFDKGHFISQPESDICAGMRKSVLEIYNIYR
DALYKNVAQLLDEVADDLTIQKAYRCVVETILEDRKNLHWRRISMVFTMLAVLAEDQRSKHHDLSWEQYNQILIKLFKEH
KIDTWINDNSGWDGFLEHIQMKHKNKLEEFIWLSTIGLWSLSVSGL
>gnl|bcl2dbpro|I3JTS4_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oreochromis niloticus (length=225 residues).
AGMANEYNRNIVEKYICHKLSKRGYVWGFRVVQEEDAANNGSITDPPPTLVHRCREASTGPDGESNTHLCRRLPQSDPHA
GIHRVLREAGDELERLYQPDFTEMSRQLHLTSATAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASNEGMSSQV
DNIADWMTEYLNGPLNSWIQDNGGWSANLQPLCLTCRPLFASWLGLFCLPFSDLCLEAGADWGRR
>gnl|bcl2dbpro|I3KLB2_uncBCL2-02 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oreochromis niloticus (length=147 residues).
QGAMAAAYNSRDLVEDFLRYKLLGRGVAWPQHPPVAPPRLQAVLRSASDELERLHGNELSAQVTVLRLRGNGGGAARRRH
LTAIREELFRDGVNWGRIVTMMELGGALSAAAAKSGDEGQVDDIASWMEESLDSPSLRRWIHDNGGW
>gnl|bcl2dbpro|I3KLB2_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oreochromis niloticus (length=169 residues).
PPSPLANTTGPSDPPVAPPRLQAVLRSASDELERLHGNELSAQVTVLRLRGNGGGAARRRHLTAIREELFRDGVNWGRIV
TMMELGGALSAAAAKSGDEGQVDDIASWMEESLDSPSLRRWIHDNGGWDAFVELYESRPTDSFWSLRTVLGLVVLGAVGV
ILGFLFSQK
>gnl|bcl2dbpro|I3KWT0_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Oreochromis niloticus (length=198 residues).
EMQCSNRELVEFFISYKLSQKNHPTSLLRPTNGGQRTERDLAQSLPAYNGIEALKSALLDSGEQFGFLFTQSFRDVASHL
SITPDTAQQCFESVMEELFRDGINWGRIIGLFVFGSAMCLDCIDSNMSELVPDIADWMTAYLDDHISLWIQRNGGWDRFT
EIFGKGMSTRSSGESLKRWLFVGVALVTGLLVGMLMTD
>gnl|bcl2dbpro|H2MQI3_uncBCL2-02 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oryzias latipes (length=189 residues).
MANVSNRSIVEKYICHKLSKRGYVCGLNGGQRENASSPRLIRAVLREAGDELERLYQRDFTEMSRQLYLTSTTAKTRFAE
VIDELFRDGVNWGRIIAFFEFGGTVCVECASNEEMSTQVASIAEWMTEYLNGPLNSWIEENGGWDAFVELYDRQKETVFT
CYWPSIKTVFGLAALGAASLTIGAYLAQK
>gnl|bcl2dbpro|H2MQI3_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oryzias latipes (length=202 residues).
MANVSNRSIVEKYICHKLSKRGYVCGLNGGQRENAESSPRLIRALSRADPLADIHRVLREAGDELERLYQRDFTEMSRQL
YLTSTTAKTRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASNEEMSTQVASIAEWMTEYLNGPLNSWIEENGGWDAF
VELYDRQKETVFTCYWPSIKTVFGLAALGAASLTIGAYLAQK
>gnl|bcl2dbpro|A0A3B3D197_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oryzias melastigma (length=225 residues).
MANVSHRSVVETYICHKLSKRGFVCGLDGGQHEDAANNGSLGDRSPTPVRRRCDAGTGPDGERSPRLIRAREPHADIHRV
LREAGDELERLYQRDFTEMSRQLYLTSTTAKTRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASDEEMSAQVASIAE
WMTEYLNGPLNSWIEDNGGWDAFVELYDRQKETVFSCYWPSIKTVFGLAALGAASLTIGAYLAQK
>gnl|bcl2dbpro|W5P8E8_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Ovis aries (length=139 residues).
MAHAGGTGYDNREIVMKYIHYKLSQRGYESPPPRPRPGVSSPRPPRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVN
WGRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHAWIQDNGGWVGARLGV
>gnl|bcl2dbpro|A0A2R8ZBL7_uncBCL2L1-02 Putative BCL2-like 1 protein OS=[Eukaryota] Pan paniscus (length=145 residues).
MWKRTGLRPQKGLNRRWRPPVPSMATHPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAA
WMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2R8ZBL7_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Pan paniscus (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2R9B9U7_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Pan paniscus (length=79 residues).
MVRSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICEMLFCPEAILLTRKDTPYCETGLIFLTLMKTIANTYFYF
>gnl|bcl2dbpro|A0A2I3T949_uncBCL2L1-02 Putative BCL2-like 1 protein OS=[Eukaryota] Pan troglodytes (length=145 residues).
MWKRTGLRPQKGLNRRWRPPVPSMATHPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAA
WMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2I3T949_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Pan troglodytes (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|H2Q9X6_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Pan troglodytes (length=79 residues).
MARSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICEMLFCPEAILLTRKDTPYCETGLIFLTLMKTIANTYFYF
>gnl|bcl2dbpro|A0A2I3N7L6_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Papio anubis (length=78 residues).
MARSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICEMLSSEAILLTRKDTPYCETGLIFLTLKKTTANTYFYF
>gnl|bcl2dbpro|A0A2I3NCI6_uncBCL2L1-02 Putative BCL2-like 1 protein OS=[Eukaryota] Papio anubis (length=145 residues).
MWKRTGLRPQKGLNRRWRPPVPSMATHPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAA
WMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2I3NCI6_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Papio anubis (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A3B3Q8Q8_uncBCL2A1-02 Putative BCL2-related protein A1 protein OS=[Eukaryota] Paramormyrops kingsleyae (length=245 residues).
MGMLKFACAAGVMAAAAGTAYLYRRFRKTPEQEEVNMATSLRDETLMVANDYMDFCIGIKRTPPSESAKAMRYMAKEVEK
EYEFRLRRLVRFFFITSGFNTWTELKNVMLEMVGHESMSWSQIVTLFAFTGILAVQLSNVDEDVACSRRLAEMITDVLLG
EKEEWIIQNGGWRGFVDYVHTAKPGYPDSPVKRALLAAANVTIAFLLVRYSISFPCYSEKCFPERFLIKFFLIYVHMVHC
CFPHD
>gnl|bcl2dbpro|A0A3B3Q8Q8_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Paramormyrops kingsleyae (length=201 residues).
MGMLKFACAAGVMAAAAGTAYLYRRFRKTPEQEEVNMATSLRDETLMVANDYMDFCIGIKRTPPSESAKAMRYMAKEVEK
EYEFRLRRLVRFFFITSGFNTWTELKNVMLEMVGHESMSWSQIVTLFAFTGILAVQLSNVDEDVACSRRLAEMITDVLLG
EKEEWIIQNGGWISYLLKRTLPGLVPSAMVIFKKLPGTSIS
>gnl|bcl2dbpro|A0A3B3QFC9_uncMCL1-03 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Paramormyrops kingsleyae (length=189 residues).
MESCEFLSRFWEGKMSCWLSKETLVLAEDYLEFCVGVQRTPPGPASEAMRCLAKEIEKQNLSKFHSLVQTFLDSCGPDRS
SSLRKVMAEMVGDGKLNWGRVVSLFAFTGVLVGELHSRGEGKDCCRRLAETIADYLGVEKQDWLLQNEGWDGFCKFFHSS
RGQNHESAMKTALFAAAGIDRMKTRLCVW
>gnl|bcl2dbpro|A0A3B3QFC9_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Paramormyrops kingsleyae (length=216 residues).
MESCEFLSRFWEGKMSCWLSKETLVLAEDYLEFCVGVQRTPPGPASEAMRCLAKEIEKQNLSKFHSLVQTFLDSCGPDRS
SSLRKVMAEMVGDGKLNWGRVVSLFAFTGVLVGELHSRGEGKDCCRRLAETIADYLGVEKQDWLLQNEGWDGFCKFFHSS
RGQNHESAMKTALFAAAGDYPLSAVGEPQHRCSLASGHGGSSSGMLRIAADSHVIK
>gnl|bcl2dbpro|A0A3B3QFC9_uncMCL1-02 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Paramormyrops kingsleyae (length=272 residues).
MESCEFLSRFWEGKMSCWLSKETLVLAEDYLEFCVGVQRTPPGPASEAMRCLAKEIEKQNLSKFHSLVQTFLDSCGPDRS
SSLRKVMAEMVGDGKLNWGRVVSLFAFTGVLVGELHSRGEGKDCCRRLAETIADYLGVEKQDWLLQNEGWDGFCKFFHSS
RGQNHESAMKTALFAAAGSENIRRILFHPLQVPSSGSACLRAPLPKQPFKIMTHVLCLEPERRVLSGLQGFEGMVISDAS
AVARGTAQIKSHTRITVSSRGTRAYYFNPNKF
>gnl|bcl2dbpro|A0A3B3RFU8_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Paramormyrops kingsleyae (length=219 residues).
MANQSTFDSRIIVENYIHQKLSNRGIDWGMDFGEETEPPANGSTDTALSRRLQTGAAAAPIRSQTTQSDPHAALHAVLRE
AGDQVERRYRRDLVEMSARLHLTPDTTESKFAAVIEELFRDGTNWGRIVAFFEFGVAVCVESVNREMTSQVDHIANWMTE
YLNGPLHTWIQENGGWEAFMELYGRRRGSSEVWPHLKAVVGLVALGVVGVPIAAYMMLK
>gnl|bcl2dbpro|A0A3B3RKL3_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Paramormyrops kingsleyae (length=297 residues).
MDVTNVKFFLVINSSIMSLLLCCKIWNGCVRIQGLYFVKDVVYEGVAFILFFVVFLTVVENPKHSNVSCSLFAVNIATSL
QEETLMVANDYMDFCIGIKRTPPSESAKAMRYLAKDVESIYGFRLRPLVQLFLVSSGFDTWTKLRNMMLEVIGGEMMSWG
QIVSLFAFMGILAVQLSTGEEDVTCSRRLAEMMTDVLIGEKQEWMIQNGGWRGFVDYVHTVRPGYPESPGKTALLTAANV
AIAGIASSKRSSCVSRPLITSCRNPDCCHLFPIPFALSLVFSPSLSQSCQIRHCDVM
>gnl|bcl2dbpro|A0A3B3S872_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Paramormyrops kingsleyae (length=191 residues).
MATSLHDETLMVANDYMDLCVGIERTPPSESAKAMRYIAKKVEDMYWLPLRRLVQSFLSNFPIHTWTELRNVMLDMVDRE
NMRWSQIVILFAFTGMLAVQMSTIDEDFTCCRRLADMITDVLRETQEWMIQNGGWRGFVDYVRIFRPEYPVSPVMRGLFT
AANVAIAFLLINYLLKRSLPGLVPFKKLPET
>gnl|bcl2dbpro|A0A3B3S872_uncBCL2A1-02 Putative BCL2-related protein A1 protein OS=[Eukaryota] Paramormyrops kingsleyae (length=227 residues).
MGIMKFACAAGVVAAAAGTAYLYRRFRKTPEQEEVNMATSLHDETLMVANDYMDLCVGIERTPPSESAKAMRYIAKKVED
MYWLPLRRLVQSFLSNFPIHTWTELRNVMLDMVDRENMRWSQIVILFAFTGMLAVQMSTIDEDFTCCRRLADMITDVLRE
TQEWMIQNGGWRGFVDYVRIFRPEYPVSPVMRGLFTAANVAIAFLLINYLLKRSLPGLVPFKKLPET
>gnl|bcl2dbpro|A0A411IAT4_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Penaeus vannamei (length=118 residues).
MAEKVNMASINMENFFSLCGELFHGGITRERIVALFTFVGDVAVHQVRHRGEQFLSVLLKWSFRYLVDHICKWVQEAGGW
GVVLNQGMNFIYKSVVFMCCLVGTVAGGVYIWKSLKEM
>gnl|bcl2dbpro|A0A3B4B2U1_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Periophthalmus magnuspinnatus (length=192 residues).
MGGRSNPSRDEGGRTRLRSDAQWVLKQWCTALDAKRTMFDKVLRGVLEDMVDELVAGEYDFDKAADEVININTLLLEDVI
VVTFVAESVFEDGVVNWGRIIAMMVFGAALGRKLQTAGQEHAMEKVVNELVVFFWKNYFSGAVQDRREIIGKVTAVLRRY
KVVPPLSTRVKVAVVACLGSLGMALGLRRWFR
>gnl|bcl2dbpro|A0A346RRN2_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Perna viridis (length=184 residues).
MDPTGTRYLVVDYVNYRLNNNGVQWGQCPSLLPQPLEVHLTLRDKGNELEARYKAVFQRRIDDLHITENTAYPVFRTVVD
EIFNGGINWGRIVALFSFGGSLATACMKKDLPQLIDSIIEWITIYIDENLSAWIQSHGGWQGFVEYYNQAQNHNDNQWNL
GEFVRYGAIGVVGALALGALLQRV
>gnl|bcl2dbpro|S4RB20_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Petromyzon marinus (length=145 residues).
VQRAMRASGDEFERRYRSAFAQLPAQLQVSQATLRARFSDVLDELFRDGVNWGRVVAFFAFGGALCAECVDKELPGLVSS
VATWMTSYLEDRLLWWIDDNGGWKALIYVAPTHLYFFSFVWSSLCLKNVKLHGYCNSLMNLLPAA
>gnl|bcl2dbpro|A0A087YSS6_uncBCL2-02 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Poecilia formosa (length=195 residues).
MANDYNRNIVENYICHKLSKRGYVWGFNGVPDDDAANNGGLGDHSPTLVRRCRDAGPGPDSDSDPHRLCRRISQSDPYAD
IHRVLRDAGDELEKLYQLDFVEMSQQLYLTRDTARTRFAEVINELFRDGVNWGRIIAFFEFGSTVCVECASKEEMTSQVD
NIAEWMTEYLNGPLDSWIQDNGGWPLKRFADLLQR
>gnl|bcl2dbpro|A0A087YSS6_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Poecilia formosa (length=229 residues).
MANDYNRNIVENYICHKLSKRGYVWGFNGVPDDDAANNGGLGDHSPTLVRRCRDAGPGPDSDSDPHRLCRRISQSDPYAD
IHRVLRDAGDELEKLYQLDFVEMSQQLYLTRDTARTRFAEVINELFRDGVNWGRIIAFFEFGSTVCVECASKEEMTSQVD
NIAEWMTEYLNGPLDSWIQDNGGWDAFVELYDRQKESVFSCYWPSIKTVFGLAALGAASVTIGAYLAQK
>gnl|bcl2dbpro|A0A3B3UCB9_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Poecilia latipinna (length=229 residues).
MANDYNRNIVENYICHKLSKRGYVWGFNGVPDDDAANNGGLGDHSPTLVRRCRDAGPGPDSDSDPHRLCRRISQSDPYAD
IHRVLRDAGDELEKLYQLDFVEMSQQLYLTRDTARTRFAEVINELFRDGVNWGRIIAFFEFGSTVCVECASKEEMTSQVD
NIAEWMTEYLNGPLDSWIQDNGGWDAFVELYDRQKESVFSCYWPSIKTVFGLAALGAASVTIGAYLAQK
>gnl|bcl2dbpro|A0A3B3Y903_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Poecilia mexicana (length=229 residues).
MANDYNRNIVENYICHKLSKRGYVWGFNGVPDDDAANNGGLGDHSPTLVRRCRDAGPGPDSDSDPHRLCRRISQSDPYAD
IHRVLRDAGDELEKLYQLDFVEMSQQLYLTRDTARTRFAEVINELFRDGVNWGRIIAFFEFGSTVCVECASKEEMTSQVD
NIAEWMTEYLNGPLDSWIQDNGGWDAFVELYDRQKESVFSCYWPSIKTVFGLAALGAASVTIGAYLAQK
>gnl|bcl2dbpro|A0A3P9N973_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Poecilia reticulata (length=230 residues).
MANDYNRNIVENYICHKLSKRGYVWGFNGVPDDDAAANNGGLGDHSPTLVRRCHDAGPGPDSDSDPHRLCRRISQSDPYA
DIHRVLRDAGDELEKLYQLDFVEMSQQLYLTRDTARTRFAEVINELFRDGVNWGRIIAFFEFGSTVCVECASKEEMTSQV
DNIAEWMTEYLNGPLDSWIQDNGGWDAFVELYDRQKESVFSCYWPSIKTVFGLAALGAASVTIGAYLAQK
>gnl|bcl2dbpro|A0A3B4F099_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Pundamilia nyererei (length=156 residues).
NCWWLRNSTGTSKASCTVWCVAKKKAPPITWAAHTDIHWATPANGKEADGVADVAKQLFLDGFVNWGRIVCLVAYGAALL
RRPNAAVSAPTSAQARGIGNAIAAHIINDHMDWFVANSGWVRHVIFLLNQESYSLPSGLLFVCGIGLSLLALALKQ
>gnl|bcl2dbpro|A0A3B4GNW6_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Pundamilia nyererei (length=226 residues).
MCQMIHWYDWQERSWHLISLALQRRSRVEMQCRNRELVEFFISYKLSQKNHPTSLLSPTSVGQRTERDLGKSLPAYVGIE
ALKSALLDSGEQFGFLFTQSFRDVASHLNITPDTAQQCFESVMEELFRDGINWGRIIGLFVFGSAMCLDCIDSNMGELVP
DIADWMTAYLDDHISLWIQRNGGWDRFTEIFGKGMSTRSSGESLKRWLFVGVALVTGLLVGMLMTD
>gnl|bcl2dbpro|A0A3B4H3M3_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Pundamilia nyererei (length=198 residues).
MAGAYSSRDLVEDFLRYKLLGRGVAWPQRQANDERAPRPDPPVAPPCLQTVLRSAGDELERLYGNELSAQVTVLQLRGSG
GGAARRRHLTAIREELFRDGMNWGRIVAMMELGGALSAAAAKSGDEGQMDDIASWMEESLDSPSLRRWIHDNGGWDAFVE
LYESRPTDSFWSLRTVCGLVVLGAVGVILGFLFSQKQN
>gnl|bcl2dbpro|A0A3B4H829_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pundamilia nyererei (length=184 residues).
MPQPRTSERVVRPCWLNIDASGPRVIVSDGLSQSVRHLNDPPTFGSGWLADAAGMIHIAGSYDTYKCVDCNIVLSGYKKA
DRSLNEHVLRMLSLQTTAAAEVSTVTRVARTLFSDGIINWGRIVSLVAYGTVLLQASKSTLGPECCSIGAPPPLLLYCPS
QGPVGGSVGSFSDPPTGRSVVTLT
>gnl|bcl2dbpro|A0A3B4CHC5_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Pygocentrus nattereri (length=208 residues).
MASKKEKVYDSRQIVEKYLHHKLAKSGHAWEEEGGEEGEEDEEEEGGGGEENRVHQAPAAVHGALREAGDELERLYQSDL
TEMAGRLELEPAVASRSFAAVADELFRDEVNWGRIVAFLEFGAAVCVERRRAAESITADVARWMTEYLNGPVLKGWIRDN
GGWDAFVDLNGRQKESVFSSSWPSIVSVFSLAALGAVGFTIGAYLAQK
>gnl|bcl2dbpro|A0A3B4ENK0_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Pygocentrus nattereri (length=236 residues).
MANESPYNIRDIVERYIQHKLLKRGYVWEFRPGAAAAATADDDDNDEAEMPRAGPARLHRLLREAGDELERAYQRDFAAM
WDQLRVAPSTQLQRSFVAVAEELFGDGVNWGRVVAFFEFGGTLCVESVNREMASQVDHISSWMTDYLNGPLLQSWIRDNG
GWDAFVEIYSQQRRSIFHPWPYLKTVFGLAALGAAGHLFSQHRTALPRTKALLSTPWSGAVLCPHACDWSGRRNKD
>gnl|bcl2dbpro|E9PU78_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Rattus norvegicus (length=170 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSAINGNPSWHLADSPEVNGATGHSSSLEAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGV
VLLGSLFSRK
>gnl|bcl2dbpro|Q7TS61_uncBCL2L2-01 Putative BCL2-like 2 protein OS=[Eukaryota] Rattus norvegicus (length=79 residues).
MEPLVGQVQDWMVTYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|Q9WUI5_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Rattus norvegicus (length=170 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSAINGNPSWHLADSPEVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQDSFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGV
VLLGSLFSRK
>gnl|bcl2dbpro|A0A2Z5U635_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Viruses] Rhinolophus gammaherpesvirus 1 (length=166 residues).
MDPPIISLVTDVMKVNLGELGFTWTGHGPPIPGSPEPLQIPLPVGCLLDAMHKCSGMYRERFGPLLDHANPQLGAYDMQL
GLFSSELFRDGVNWGRIVAFFSFGSSMGINLAKQGINPGPMCRMLSETLERLAGPWIRDHDGWDGLVDWWLTRGDWSIWN
LQCSIL
>gnl|bcl2dbpro|A0A2K6P5R9_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Rhinopithecus roxellana (length=78 residues).
MARSRLTATSVSQVQENGFVKKLEPKSGWMTFLEITGKICEMLSSEAILLTRKDTPYCETGLIFLTLKKMIAHTYFYF
>gnl|bcl2dbpro|R4TE41_uncBCL2L2-01 Putative BCL2-like 2 protein OS=[Eukaryota] Ruditapes philippinarum (length=188 residues).
MRMDEDDFSIGTSGIVAEYITYKVQQAGFDYQVSPTRNCPNNKVIDTVKKLCSEFEKRYESQFTEMCETCSQVELNSANY
VAVLDQLIVNGLHWGRVVAIFSFAGAMSVYCMKKNQKERVDWIREWTCQFMDSKVENWINENNGWRGLIDFYTNGIKKPE
EKTNGWGSVLIGGALGAFALGALIINKA
>gnl|bcl2dbpro|R4TGI6_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Ruditapes philippinarum (length=231 residues).
MTTTSPTYGGIKSLGGNGGFHNNSNLFAEIHKHWGLLPGNQGLNNINQETQTTGSMLSPLENVRKQAEIIATAVVVNFGL
DCEKKCPDRFCKTMRKTVQEVSDRHDIALKSMVNKLNLDDSNMFATFVNVADEIFEDGQINWGRVIVVYAFAARLNAYFR
QGNPTYEEKISLYVGKYVGNKLGRWILDNGGWDAFADFFSDENAVEDKIWKGLLFTATLGGLGALAAVMSR
>gnl|bcl2dbpro|B5X106_uncBCL2L10-01 Putative BCL2-like 10 protein OS=[Eukaryota] Salmo salar (length=196 residues).
MSCGLWKETLAIAEDYLSVCSIIPASGSWKAPPGPPPSDSAAAMRRQARDMEAKHRARFHALAHSFLCQCGPDPCACLRR
VMEELVGDGQMNWGRVVSLFTFTGVLVRELQGEDMDQGLGNGMGLGGKESCRALAETIADYLGEEKSDWMLENKGWEGFC
KFFHTAREVNQDSSMKTALFAAAGVGIAGLTFLLVR
>gnl|bcl2dbpro|A0A132A3U0_uncBCL2L2-01 Putative BCL2-like 2 protein OS=[Eukaryota] Sarcoptes scabiei (length=150 residues).
MDSQLMSLIKDFYNSQFELMKAPRPFPNVSSGTITMTTPSDYHQIISSLKALGRLIQKNYEKHFLEIIKKFDKKIEPSNC
CASFYCLSNAMFVKGIQWNHIVTYFVFSAYFAHYADQEDAASVSDVALWLCRFVSERLLDWIETNGGWNF
>gnl|bcl2dbpro|G4VMZ9_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Schistosoma mansoni (length=298 residues).
MPQNEIQPTSNEPSATTNTTTLPSTSLVYHQSHQSVPSTFISARLILCARNLADHFESRYRDLLQSINRDVARLNNDQSC
TEDTNKTTMISVNDNVTNVRDTNTSVKSDSRIGDGDASGAASHVSDDSLQTRLEMARCQFHSVLEELFLERINWGRIIAM
LAFLRTLCEVVEENNKHMNYSVSHQSVPQSHDVSKSTDLPIISCEQLEHNDDVTSDCNKQLSSTDPSASCSDKNTDKKLQ
DKDLETSMDPHQSNVSNLHLMSFTRPCAADYTLWTVEFIHGPRGLWNWISSHGNWVSK
>gnl|bcl2dbpro|C9WPR4_uncBCL2L1-02 Putative BCL2-like 1 protein OS=[Eukaryota] Schmidtea mediterranea (length=184 residues).
MSYVKTMTLNYDDKDYIHSLLNGLVKLAGIDQQLNDRNCLNDDIVQCLHSLVVEAQDRGKDTISNFSSILNKPTDDDKKQ
SFYIVVESLFNDCIRWSRVIVAFMYIIQVLKISKNEYKKYFEWSVELILTKIYPWVRENGGWEQIVQISKNRNHLEEVTE
TMKQFGKVALGITGLFALGKWIFN
>gnl|bcl2dbpro|H2DL19_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Schmidtea mediterranea (length=192 residues).
MEDRIIFQPSGLLKDSRVYNIECDLDFLPPIDIIDKIMIDFVMYRISIRGFPDLNIFPNKVGRTKYHSVTNEILNKLTDK
ADEFERQYYPRFENRKSLLEKIPERAFLDFIDTLHGIFEDNQINWGRIIGYFTFVGSYCTACIEHGMVRIVYNLVEYAIK
YMNTNLSGWMSSNGGWRGLGMALSTESFELRF
>gnl|bcl2dbpro|A0A2U9B3E4_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Scophthalmus maximus (length=125 residues).
MIVALERTKGPGTVTQEAKAVFVDGVVNWGRIVSLVSLGAAICQSRGFECRGSGENATETVEEEIASYLLKEHEDWLVAN
DYSDGFVAFFKTPGTSDREDLGQLPLRPILAIGAVLLTCTLFRFK
>gnl|bcl2dbpro|A0A2U9BDX9_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Scophthalmus maximus (length=466 residues).
MCDQTFVAVTFGPCDNCTKASPLMNIYIKTEAINYCSLCVELMACQGLQKGETLASLKTESDGLKKKLEVERGKLNDVEL
HQVAEKTEVLGALSIKTRRVLKGHGAKVLCMDWCKDKRRLVSSSQDGKVIVWDAFTLNKEHGVSLPCTWVMACAYAPSGC
AVACGGLDNKCSVIPLSLDKDENLAAKKKSVAMHTNYVSGCTFTNSDMQMLTSSGDGTCALWDVESGQLLQSFHGHTADV
LSLDLAPSETGNTFVSGGCDRKANVWDMRSGQNIQSFESHESDINCVKYYPSGDAFASASDDATCRFYDLRADREVAVYQ
KDSIVFGASTVDFSLSGRLLFAGYNDYTINAWDVLKGNRVSILFGHENRVSRVKLSPDGTAICSASWDNTLRELAQGPGS
CRGLAETIADYLGEEKKDWLLENDGWDGFCKFSRSAREMSQDSSMKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A411F0J3_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Scylla paramamosain (length=235 residues).
MSPEVNKEPVASKVPSDNETDEGFHSPSTSRSELRCSKEEEATTNPAESQNSANKTREKPDNDVIKARRLAEFTVLTVTG
RSKSPPQDSVEETLIRCVRSMMQKHEILLRGMMRRLDVRPETGYQAFVGVANELFEGQKRAVTWGRVVALYAFGAQLALH
CTEKKEEEFCGRIVEFLGQYASEVLVPFVKQDGGWTKICEEFPAEVDLESKAWKVLTWTAIGLGLAATASFFTSH
>gnl|bcl2dbpro|A0A3B4U6P3_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Seriola dumerili (length=225 residues).
MAAVYTSRDIVEDFLHYKLLNKGVAWRFPPPPRQSGAQRVHQEASSATSRTSGRGVAPGDAQQDPWSTPPRLQVALRCAG
DELECSYRGNLSAQVSALLPCRDGDGGGSRSARRQSLTVVREELFRDGVNWGRIVAMMELGGALSAEVAKTGGAWQVDDI
ARWMEESLDSPPLQGWIEDNGGWNAFVELYGESRPPVSFWSLKTVFGLVVLGAAGIALGALFTQK
>gnl|bcl2dbpro|A0A3B4WW18_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Seriola lalandi dorsalis (length=212 residues).
MASEYNRNIVEKYICHKLSKRGYVWGFDDVRDEDAANNGSIVAPPPTLVRRCREANTGPDNDSSPNLCRRLSQSDPHAEI
HRVLREAGDELERLYQPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECAAKEEMTSQVDN
IVEWMTEYLNGPLNSWIKDNGGWVGLIPSAYKCSVGIKTCILTRHTISKAHL
>gnl|bcl2dbpro|A0A3B4YFW5_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Seriola lalandi dorsalis (length=164 residues).
MMTSLVSSLVIGCLLLDPWSTPPRLQVALRCACDELECRYRGNLSAQVSALLPCGDGGGDGSRSAQRQSLTVVREELFRD
GVNWGRIVAMMELGGALSAEVAKTGGAWRVDDIARWMEESLDSPLLQGWIEDNGGWVGRQQVLFLSFFFWLTVSWVTNKL
TSLQ
>gnl|bcl2dbpro|A0A3B5AUF2_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Stegastes partitus (length=205 residues).
GAMAAAYSSCDIVEDYLHYKLLSRGVAWRCSPPPGRTGGRRPGRAETSHLQGEKAVTVVMAALRSAGDEVARCCHGNLWA
HVSALRLCEGGAVQRRSLEAVSEELFRDGVNWGRIVAMMELGGALSAEAAEAGDMRQVDAIAGWMEDSLDSLPLRGWIED
NGGWDAFVQLYESRPPVSFWSLRAVFGLVVLGAVGITLGALFTQK
>gnl|bcl2dbpro|T1JCZ5_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Strigamia maritima (length=204 residues).
MGDNRTVEMNEETRSLVQDFIIHSMEERGVAVPQPPLRSPTPLSRKLRQVTCEFEQKNRTSLDEMFVTLQEQGNQQMEVN
AHLAFQGVINELFREGITWSRIVAMFAFAGGLAVRFTQDLDQIVEDLTQFIEHTLQSWIADNGGWVRQHMRLLFIVGFAS
ARTNAFSWNRNNIPGISDGFSKMRIILSFSIIDWSEIRFFGFVT
>gnl|bcl2dbpro|W4Y4Z4_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Strongylocentrotus purpuratus (length=224 residues).
MTESILAASSPQKSNYNKQLGQNLFFNGNVRKEQPPSPDEEVNGHPLVEEGESGLIARQLGDDYISYKVGKQHGRRPPCQ
HAETLRRVGDEVEERYAITLNGLVNNLEYDPDKDGEEAFTASLNAMFEEGSCNWGRVVMVYVFAARLAKYCQENGKGYHV
GSLADFAGRYVASRLTPWINKQGGWEKFDESFKAKDWKEKAAFNSLLVTGAFLGGLAALRLLMK
>gnl|bcl2dbpro|W4YMX7_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Strongylocentrotus purpuratus (length=165 residues).
MPLWKWICKTTFIDLSKLRMNDSETTKLIEDYCIHRIRKESIELASYQHVSREPYAPVAARMREIGVTWGRIAALIAFSG
RLSVHCASNNLEDLVPSIIGWTSRYIGSKLLPWMQDHQNWDGFMAFFEENGKVRARETVSSIMSSACRFAVFGAGIAALA
CLLRR
>gnl|bcl2dbpro|W4Z8J6_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Strongylocentrotus purpuratus (length=153 residues).
MPDISTASIVADYLRYRLQCLGNGVDAEENDCLSTVMSSVENVPEDLHEAIVNLSEKLMNDYRDSFSDMPNQLKITENTI
SSTFKAVTSELFVDGVISWGRIVAFFSFGGALCEWCQEKDIPRAFPTVEELMVAYINSHLITWIHANGGWVMK
>gnl|bcl2dbpro|Q5TJD7_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Suberites domuncula (length=218 residues).
MTTESPSLHGSSGGNNNRERVDNNYGLPDDMTIDNEHIEELARSYIVNLLRREGLNHIADQFAPVGSTRANGYQLIERIV
CQLEDERSQQFIDILRGLEIDQQNLRITYQTIVGEIFNDGVHWGRIVAFLVFSGHLAVHCARSNGLENRVRDVVEWTEAE
MRLRVHQWVEDRGGWEAFIQHFDRNTLWNFDLSTIAVSAAMIAALFAAGLFTVKRFLS
>gnl|bcl2dbpro|Q9N754_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Suberites domuncula (length=218 residues).
MAEALLTTISMTHPDNDSELILVMQQSACLSYHLTYYLLNQGGIKLNGYAGNGRTSHTRNRLTNDKKFREAISTLESSCK
QMKSKYQQEIEGLVKTLDISDTQLYTNFQHAANSLMDGDIRWGRIAVLFFFTSVLAKRLHKDGHSHQISSLIGWLTTFLN
DNATSWILENGGWAAIKDSVNVEEKQQPPTVEKAQKSSWLTIAAVGVGAVVVGALAIR
>gnl|bcl2dbpro|A0A286ZMU0_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Sus scrofa (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEAETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTLAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A286ZMU0_uncBCL2L1-02 Putative BCL2-like 1 protein OS=[Eukaryota] Sus scrofa (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEAETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTLAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A286ZMU0_uncBCL2L1-03 Putative BCL2-like 1 protein OS=[Eukaryota] Sus scrofa (length=175 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEAETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGM
TLAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A286ZMU0_uncBCL2L1-04 Putative BCL2-like 1 protein OS=[Eukaryota] Sus scrofa (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEAETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTLAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A286ZMU0_uncBCL2L1-05 Putative BCL2-like 1 protein OS=[Eukaryota] Sus scrofa (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEAETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTLAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A1Z1EDU3_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Tachysurus fulvidraco (length=204 residues).
MANQSPYDNRDIVEKYIYQKLLKRGYVWEFRAGAEEDDGLREPPAEVVDRRPRALLPLHRVLREAGDEIERTYQRDFAAM
SDQLHLTPSTAQRRFTAVIEELFRDGVNWGRIVVFLEFGSTLCAQSVNQEMASQVDNIASWMTDYLNGPLQNWIRENGGW
DAFVELYSHQRASIFHPWPYLKTVFGLAALGAAGVTIGALFSQK
>gnl|bcl2dbpro|H0ZU95_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Taeniopygia guttata (length=37 residues).
GFVDFFRLEDLEGSVRNVLMAFAGVAGLGASLAYLIR
>gnl|bcl2dbpro|H2RZ55_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Takifugu rubripes (length=174 residues).
MSNRELVENYLIYKLSQKYPGTVSPPAGTGREALNAALRSMANKYERDFMEQAGDLSPYVAVTRNKAGFNKVMDDMFRDK
INWGTVVGLFVVGGATYVQSFEGGASEPVCHVADWMTDYLDQRINPWIESQGGWVNRRKWILGGLVVLAGVLIIVTKNYG
TLRKAFSNFMSYWS
>gnl|bcl2dbpro|H2SIR7_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Takifugu rubripes (length=213 residues).
TSLKSVYFLNCKTQRNLELVENYLIYKLSQKNYSGTLLRPKGASSGLLVDRESSGASPSAGTGREAVIAALRSMANKFEQ
DFIQLAGDLSSYVAMTRNQACFNKVMDDMFRGEINWGTVVGLFVVGGAICVQSVEGDASEPVCHIADWMAAYLDKRINPW
IESQGGWKPAQSQEERRKWILGGLVVLAGVLIIVTKNYGTLRKAFSHFMSYWS
>gnl|bcl2dbpro|H2SKE0_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Takifugu rubripes (length=225 residues).
MERECNRDIVENYICHKLSKRGFAWSFEDVQDENAANNGSVVAPAPTLVRRCHEAGTGPDRDRGSISHPCKEPPASDQHA
AIHRVLREAGDELERLYQPDFTEMSRQLYLSSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGAVCAECAAKEEMSPQV
DNIAEWMTEYLNGSLNSWIQDNGGWVGVIQRRSRFPRLTRELGDAPLAARQHFLTRNSSADGPRR
>gnl|bcl2dbpro|H2UHW0_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Takifugu rubripes (length=172 residues).
REKCLFGNYLIYKLSQKNYPGTLESSGTSPSTGTGREDVNAALWSMANKFEQDFIQLAGDLSSYGAMTRNQASFNKVMDD
MFSDEINWGTVVGLFVVGGAICGQSVEGDASEPVCHIADWMAAYLDKRINPWIESQGGWVSVKERDSKYSFLCPGILESA
LKQFCLYKTLYK
>gnl|bcl2dbpro|H2UHW1_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Takifugu rubripes (length=220 residues).
SISQRVCRRVGKNGEPQEAGGGAPELVENYLIYKLSQKNYPGTLLRPKDASSGLLVDRESSGTSPSAGTGREAVIAALRS
MANKFEQDFIQLAGDLSSYGAVTRNQASFNKLMDNMFSDEINWGTIVGLFVVGCAICVQSVEGSASQPVCHIADWMTVYL
DKRINPWIENQGGWVSVKERDSKYSFLCAAVRDLMTKIQPLFFFFRMTNGHELIRGIVFI
>gnl|bcl2dbpro|A0A346FR88_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Tegillarca granosa (length=233 residues).
MATDSQHIGENNGKVTNIYSLKKGSLFAEINKQLGLLPGFQGLSQDLNKLDQETQTPGSSTPLENVRHQAEVIASDVIKS
FVGDCDKKPPNRYCKTMRRTVKELSERHDIAFKGMVNKLNVNDTTAFPTFVSVVDEIFEDGQINWGRIVAVYTFAARLSK
HCNEESPDCDERIALYAGKYVASKLGRWILDNGGWEAFADYFPEQGAMEDKLWKGLVYTAVGLGALATMVASR
>gnl|bcl2dbpro|H3C1U2_uncBCL2L10-01 Putative BCL2-like 10 protein OS=[Eukaryota] Tetraodon nigroviridis (length=182 residues).
KMSCGLWKETLALAEDYLSVCCASQMRSLAQDLEQQHQARFHSLAHSFLRQCGLDPCSGLRTVMEELVGDGHLNWGRVVS
LFAFTGVLARLMQEQKSTKPGPDPGLEQDLGQAPGACRALAETIADYLGEERKDWLLENGGWEGFSKFSLSAREVSHDSS
MKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|H3C3G9_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Tetraodon nigroviridis (length=191 residues).
MAREYNRDIVEKYIFHKLSKRGFVWRFEEVQDQNAANNGSVVAPAPTLVRRCHEAGTGPDRGSIPHLCKRTPQSEQHAAI
HRVLREAGDELERLYQPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGAAVCAECAAKEEMSPQVDN
IAEWMTEYLSGSLNSWIQDNGGWRRFKKVTG
>gnl|bcl2dbpro|Q4SCG3_uncBCL2L1-02 Putative BCL2-like 1 protein OS=[Eukaryota] Tetraodon nigroviridis (length=146 residues).
LRKVTDDFEKKLTRACGDLSSYLPSKISHQNFNNTMDQIFEGNVHWGVVIGLFVVGGAMCVQCVRNNHEELVCHIADWMT
AYLDEHLEPWIQRQGGWEDFTRRYETVDERSQFERGAKLCFLTLLLVGGFVIFRKYNVFHRLLRFL
>gnl|bcl2dbpro|Q4SCG3_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Tetraodon nigroviridis (length=207 residues).
MSHTNRELVEFYLNYKLSHSNFLTSLRASADAWQSPRISRRDRSGASPSSDAGRRAVKAVLRKATDDFEKKLTRACGDLS
SYLPSKISHQNFNNTMDQIFEGNVHWGVVIGLFVVGGAMCVQCVRNNHEELVCHIADWMTAYLDEHLEPWIQRQGGWEDF
TRRYETVDERSQFERGAKLCFLTLVLLVGGFVIFRKYNVFHRLLRFL
>gnl|bcl2dbpro|A0A1B1IJN9_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Trichoplax adhaerens (length=211 residues).
MTSSFDEASSQKIKTLKPTLTNFKGTNGFLDDEQFLVYKNIIKDYIQSRLLNEGLLDGPYRCDIKDVKTKKVSERLKEVG
NELEGKFKDSFSNMCERLTITDTTAYPTFVGVVNELFSTGINWGRIVAFIVFSSRLAIHFKRNGMPEYVKSVYGWVARYM
HTKLSTWIEANRSWDGFLDHFDKKNENEKSSIFTATMAVAIGTCAYFLFNR
>gnl|bcl2dbpro|B3RSA4_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Trichoplax adhaerens (length=215 residues).
MSPEREKMVETNIANSESTENYANGTSYLQPVNDEEMCRESRQLAYDFVYEVVGEKNPVSYIRKRSSSRCIKKLNRMTKV
MLERHDIPFKSACTKMKLSKDAPVRRMLQSIAAEMFRNGCNWGRITALFALCRKLAINSKELGYYDIIYKIAGCLADILT
GQLHSWIAAKGGWDEYVSYFRDTEDVQEDAKKFLMYTTLALTASFAVALAVWERW
>gnl|bcl2dbpro|A0A144KBE2_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Urechis unicinctus (length=234 residues).
MDVTDSVIVPERFSLQKNNNYSQRNGFTTTDRPILKAESKSKMVSITTNLEQSTQTPKSLNVDNVKQVAKELAVDIVNYV
SGHKHSKPVNQHAITLRRTVDELSEKHEIVFNSIVKKLQPLTRDTAVQTFFNVMDEMFRDCSYNWGRVVSVYAFGGRLAK
HFVDIKATDFVEKVAECLGTFVAEKLSKWIHQQGGWDAFDAYFPERSSMETVIWKSLVMTAFGLGALATMVAVR
>gnl|bcl2dbpro|A0A3B5MJB9_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Xiphophorus couchianus (length=212 residues).
MANDYNRIIVENYICHKLSKRGYVWGFNGVPDDDAANNGGLGDHSPTLVRRCRDAGPGPDRDSDPHSLCRRISQSDPYAD
IHRVLRDAGDELEKLYQLDFVEMSQQLYLTRDTARTRFAEVINELFRDGVNWGRIIAFFEFGSTVCVECASKEEMTSQVD
NIAEWMTEYLNGPLDSWIQDNGGWVGLIQPLKLGALWLYLQLRTESTREIGH
>gnl|bcl2dbpro|A0A3B5QUY0_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Xiphophorus maculatus (length=229 residues).
MANDYNRIIVENYICHKLSKRGYVWGFNGVPDDDAANNGGLGDHSPTLVRRCRDAGPGPDSDSDPHRLCRRISQSDPYAD
IHRVLRDAGDELEKLYQLDFVEMSQQLYLTRDTARTRFAEVINELFRDGVNWGRIIAFFEFGSTVCVECASKEEMTSQVD
NIAEWMTEYLNGPLDSWIQDNGGWEAFVELYDRQKESVFSCYWPSIKTVFGLAALGAASVTIGAYLAQK
>gnl|bcl2dbpro|A0A067RGX7_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Zootermopsis nevadensis (length=131 residues).
MLDKHVLLFTSFAKRLARTPENISEQFLVVSEELFQDCVTWSRIIALYALAGRLALYYRENNMQKLAESIPQCMAHCIAG
KIASFVIKNGGWEQLCVEFPPKKDLSVKVWRSLLVTGAALGIVAALLMVHS
© 1998-2019