Dataset for protein Bcl2l10 of organism all

[Download (right click)] [Alignment] [Repertoires]

70 sequence(s)

>gnl|bcl2dbpro|A0A3Q1GM98_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Acanthochromis polyacanthus GN=BCL2L10 (length=194 residues).
MSCGLWKETVVLAEDYLSLCCAGPHQAPPPPSESAAAMRRLAQDMEKQHQARFHSLTQAFLRQCGPDFCSSLRMVMEELV
EDGHLNWGRVVSLFTFTGVLARQLLEQKDTKPGLDPGKRQELGQRPVNCRGLAETIADYLGEEKKDWLLENDGWEGFCKF
SLSARKASQDLSMKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|G1LKR4_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL2L10 (length=193 residues).
MADALRGTARLLTDYLEYCAREPGTPARAPSTPEAAVLRSVAAQVQQRHERFLSDYRGYAGGNRVELVAQVEREILAHPQ
PLSWGRVVALLTFAGTLLERSPSGTYSNLGPDQELELGEWEAGVRQDCRHLVDFLCNRLTGQHRAWLEAHDGWDGFCLFF
TPMLPSSWKRLLAQALLSCFTAVILIYFWKRLL
>gnl|bcl2dbpro|A0A3Q0S9R1_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Amphilophus citrinellus GN=BCL2L10 (length=191 residues).
MVPGLWKETLGLAEDYLSLCCTSPHQVPPPPSESAAAMRRLGQDIERQHQARFDNLAQTFLRHCGPDHCSSLRKVMEELV
GDGHLNWGRVVSLFAFTGVLARKRLEQKPGLDPGQQQELGQEPISCRELAETIADYLGEEKKDWLLDNDGWEGFCKYSRS
AREVSQDSSMKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3Q1D2L0_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Amphiprion ocellaris GN=BCL2L10 (length=194 residues).
MSCGLWKETLVLAEDYLSLCCASPHQAPPPPSESAAAMRRLAQDMEKQHQARFHSLTQTFLRQCGPDLCSSLRKVMEELV
GDGHLNWGRVVSLFTFTGVLARQLLEQKDTKLGLDPGKQQELGQGPVNCRELAETIADYLGEEKKDWLLENDGWEGFCKF
SLSAREVSQDLSMKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3P8RL82_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Amphiprion percula GN=BCL2L10 (length=194 residues).
MSCGLWKETLVLAEDYLSLCCASPHQAPPPPSESAAAMRRLAQDMEKQHQARFHSLTQTFLRQCGPDLCSSLRKVMEELV
GDGHLNWGRVVSLFTFTGVLARQLLEQKDTKPGLDPGKQQELGQGPVNCRELAETIADYLGEEKKDWLLENDGWEGFCKF
SLSAREVSQDLSMKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3Q1IAB0_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Anabas testudineus GN=BCL2L10 (length=243 residues).
MFQLSWGLFLLEAESADKCADAEGKLRVHRGSPSAVRMCREQTDIAGRKMSCGLWKDTLALAEDYLSLCCTSPWPAPPPP
SESAAAMRRLAQDMEKQHQVRFHSLAQTFLKQCGPDPCSSLRKVMEELVGDGHMNWGRVVSLFTFTGVLARQMLEQKDKK
PGLDLGKGQELGQEPGQCRGLAETIADYLGEEKKDWLLENDGWEGFCKFSCSAREVSQDSSMKRALFAAAGVGLAGLTFL
LVR
>gnl|bcl2dbpro|A0A2K5F974_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2L10 (length=213 residues).
MADPLRQRTERLVADYLEYCSQEPGTPESPPSTAEAAVLRAMAAGVRKLYRSFFSAYLGYPGNRVELVARMAEALLSDSP
GPTWGNVVMLLAFAGTLLERGPLVTARWKKWGFQSRLKEPEGDVARDCQRLVALLSSRLVGQHRAWLEAQGGWVSMRRGT
RASRVAGNIGWLLLLLQDLLLAGIMEKTAGPGFPVMVVNSSIHLLLDTIIRSF
>gnl|bcl2dbpro|A0A3P8PVZ8_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Astatotilapia calliptera GN=BCL2L10 (length=273 residues).
MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTHSASAEGKTQLYRRSPSAVCMCREQSDIAGR
KMKFCGLWKETLVLAEDYLSFCCTSPHQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPDHCLSLRKVMKE
LVGDGHLNWGRVVSLFAFTGVLARKILEQKPGLDPRQQQELGQEPMSCRRLAETIADYLGEEKKDWLLDNDGWEGFCKFS
RSAREVSQDSSMKKALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|E1B9B3_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Bos taurus GN=BCL2L10 (length=248 residues).
MTEGGAMVDPFRERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARIQEANRNVLPLYRRCRRHRVELVARMAQR
LLDEDPGPSWGRVASLVTFAGSLLERPPQTTRRQEKRDDDGVSRDCRLLVALLCAQFCERHRAWLMTNGGWVSAKDAGLV
GSLGRAHAAGWILSLLQPLIPAILGKTAGLVFPLILDSNNHNLLLDKIIVSSKILISTCLTLSNQAKLKCERPNQSKPPS
ETFLSAFM
>gnl|bcl2dbpro|F1MV39_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Bos taurus GN=BCL2L10 (length=187 residues).
VADGQESLVERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARIQEANRNVLPLYRRCRRHRVELVARMAQRLLD
EDPGPSWGRVASLVTFAGSLLERPPQTTRRQKRDDDGVSRDCRLLVALLCAQFCERHRAWLMANGGWDGFCLFFSQSFQP
SWERQLVWFFLAYWTAIIIIYFWIKLL
>gnl|bcl2dbpro|F7CT87_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L10 (length=226 residues).
MADPLRQRTEQLVTDYLEYCSREPGTPESPPSTAEAAVLRAVAASVRKLYRSFFSAYLGYPGNRVELVARMAEALLSDSP
GPTWGNVVMLLAFAGTLLERGPLVTARWKKWGFQSRLKEPEGDVARDCQRLVALLSSRLVGQHRAWLEAQGGWVSKEGDT
GRDRHLGTARPRWLLLLLQDLLLAGIMEKSAGPGFPVMVVNSSIHLLLDTIMRSFKSFSPLLPAQL
>gnl|bcl2dbpro|A0A2K5MMZ4_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Cercocebus atys GN=BCL2L10 (length=194 residues).
MADPLRERTERLLADYLGCCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSAYRGYRGNRVELVALMAEAVLSDSP
GPTWGRVVSLVTFAGTLLEREPLVTAWWKKRGFQPRLKEQEGDVARDCQRLVALLSSRLAGQHRAWLQAQGGWDGFCHFF
RSPFPLAFWRTLLIQAFLACLLATAFGYLWTRLL
>gnl|bcl2dbpro|A0A0D9RG38_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Chlorocebus sabaeus GN=BCL2L10 (length=193 residues).
MADPLRERTERLLADYLGCCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSAYLGYPGNRVELVALMADAVLSDSP
GPTWGRVVSLVTFAGTLLEREPLMTAWWKKQSFQPRLEQEGDVARDCQRLVALLSSRLAGQHRAWLQAQGGWDGFCHFFR
SPFPLAFWRKLLIQAFLACLLATAFGYLWTRLL
>gnl|bcl2dbpro|A0A2K5K3B0_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BCL2L10 (length=204 residues).
MADQLRERTNVADPLRERTERLLADYLGCCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSAYLGYPGNRVELVAL
MAEAVLSDSPGPTWGRVVSLVTFAGTLLEREPLVTAWWKKRSFQPRLKEQEGDVARDCQRLVALLSSRLAGQHRAWLQAQ
GGWDGFCHFFRTPFPLAFWRKLLIQAFLACLLTTAFGYLWTRLL
>gnl|bcl2dbpro|A0A3P8W7K5_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Cynoglossus semilaevis GN=BCL2L10 (length=217 residues).
MCNSASPSAVSTSSEQSDIAGRKMSCGLWKETLAVAEDYLSLCCSSPRPAPPPPSESAAAMRHLAQDMEKQHQARFQTLS
QSFLRQCGSEPCVCLRKVMEELVGDGHLNWGRVVSIFTFTGVLAKQLLVQKGLKPGQEPEAGQELGPEPGTCRELAETIA
DYLGEEKKAWLLENGGWEGFCEFSHSARELSQDSSMKTALFAAASVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3Q2GL87_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Cyprinodon variegatus GN=BCL2L10 (length=206 residues).
MCREPLHITGRKMSCGLWKETVAVAEDYMRLRCSSPLPAPPPPSEPAAAMRRLAQDMETQHQARFHTLAQSFLRHSGTDL
CSSLRKVMDEMVGDGLFNWGRVVSLFTFAGVLARQLQEQTGKNPGLDPGRQQELQTEPVSCRALAETIADYLETHKKDWL
QENNGWDGFCNYARNAREVSQDSSMKTALVAVAGVGIAGLTFLLVR
>gnl|bcl2dbpro|F6ZPD4_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Equus caballus GN=BCL2L10 (length=184 residues).
VAEALRERTALLLIDYLQRRAREPATPEVAVLRCVAAQIQPRNQRVLSRYRGFRGDHVGLAARMAQAIFGDRHVPSWGRV
AALVTLAGTLLERAPRGTYRKPKRGYKLELREWKAGVDRDWLRAWWTSCAHGSRGGTAPGWRLTMDGFCDFSLTLPASQR
ILLVRFLLSCFSASVLIYLWTKLS
>gnl|bcl2dbpro|A0A337RYG8_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Felis catus GN=BCL2L10 (length=192 residues).
MADALRERTAQLLTDYLEYCAREPGSPARTPSTPEAAVLRYLAAQIRQRHQRFLSAYRGYRGNRVELVARLEQDLLSNPQ
TLSWGHVVALLTFAGTLLERPPPGTYLNLTPDQQQELEWETNVGQDCQHLVALLCNRLTGRHRAWLEAHDGWDGFCLFFS
PMLPSSWRRLLVQALLSCFTVMILIYFWRRLL
>gnl|bcl2dbpro|A0A3Q2PJS5_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Fundulus heteroclitus GN=BCL2L10 (length=202 residues).
MCREPSHIAGRKMSCGLWKETVAVAEDYMRLRCSSPHPAPPPPSEPAAAMRRLAQDVESQHQARFHALAQSFLRHSQTDL
CTSLWKVMDEMVGDGHFNWGRVVSLFTFAGVLARQLQEQQGRSPGPDPGRQQEPVSCRELAETIADYLEKHKKDWLQEND
GWDGFCNYAHGARGASQDSSMKTALVAVAGVGIAGLTFLLVR
>gnl|bcl2dbpro|D2IT42_BCL2L10-02 BCL2-like 10 protein OS=[Eukaryota] Gadus morhua GN=BCL2L10 (length=195 residues).
MSCRLWKETLALSEDYLLSCTASTGTAPPPPSESAAAMRGLAQDMERQHYARFQALAQSFLAQCEADACAGLRKVMEELV
GDGQLNWGRVVSLFTFTGVLARQLQEKKGVQLGQDPGTGRALGQVPGGSCRGLAETIADYLGEEKRDWLLENGGWEGFCK
FSRIAREVNQESSMKTALFAAAGVGIAGLTFLLVR
>gnl|bcl2dbpro|G3QLU6_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2L10 (length=204 residues).
MVDQWRERTTMADPLRERTERLLADYLGYCAREPGTPEPTPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVAL
MADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLMGQHRAWLQAQ
GGWDGFCHFFRTPFPLAFWRKQLVQAFLSCLLATAFIYLWTRLL
>gnl|bcl2dbpro|A0A3Q2UUP0_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Haplochromis burtoni GN=BCL2L10 (length=273 residues).
MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTHSASAEGKTQLYRRSPSAVCMCREQSDIAGR
KMKFCGLWKETLVLAEDYLSFCCTSPHQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPDHCLSLRKVMKE
LVGDGHLNWGRVVSLFAFTGVLARKILEQKPGLDPRQQQELGQEPMSCRRLAETIADYLGEEKKDWLLDNDGWEGFCKFS
RSAREVSQDSSMKKALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3Q2UUP0_BCL2L10-02 BCL2-like 10 protein OS=[Eukaryota] Haplochromis burtoni GN=BCL2L10 (length=271 residues).
MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTHSASAEGKTQLYRRSPSAVCMCREQSDIAGR
KMKFCGLWKETLVLAEDYLSFCCTSPHQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPDHCLSLRKVMKE
LVGDGHLNWGRVVSLFAFTGVLARKILEQKPGLDPRQQQELGQEPMSCRRLAETIADYLGEEKKDWLLDNDGWEGFCKFS
RSAREVSQDSSMKKALFAAAGVGLAGLTFLL
>gnl|bcl2dbpro|Q9HD36_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Homo sapiens GN=BCL2L10 (length=204 residues).
MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVAL
MADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLMGQHRAWLQAQ
GGWDGFCHFFRTPFPLAFWRKQLVQAFLSCLLTTAFIYLWTRLL
>gnl|bcl2dbpro|Q9HD36_BCL2L10-02 BCL2-like 10 protein OS=[Eukaryota] Homo sapiens GN=BCL2L10 (length=241 residues).
MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVAL
MADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLMGQHRAWLQAQ
GGWVSTRRTPGHGAGRAAGKRPRGWHGWLLSLLQDPLSTGFLEKTAGPGFSVMLVNNSLHLSLDTIIMSFKTFNPLLPAQ
L
>gnl|bcl2dbpro|A0A3Q3EZU5_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Labrus bergylta GN=BCL2L10 (length=206 residues).
MCRAQSDIAGRKMSCGLWKETLALAEDYLSLCCTSPRPAPPPPSMSAAAIRRLAQDMEKQHQARFQSLAQTFLRQCGPDP
CSGLRKVMEELVGDGHLNWGRVVSLFTFTGVLARQLQEQEDVKLGLDPVQGQKLGQGPGHCRGLAETIADYLGEEKKEWL
LENDGWEGFCEFSRSARETSQDSSMKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3Q3EZU5_BCL2L10-02 BCL2-like 10 protein OS=[Eukaryota] Labrus bergylta GN=BCL2L10 (length=209 residues).
MCRAQSDIAGRKMSCGLWKETLALAEDYLSLCCTSPRPAPPPPSMSAAAIRRLAQDMEKQHQARFQSLAQTFLRQCGPDP
CSGLRKVMEELVGDGHLNWGRVVSLFTFTGVLARQLQEQEDVKLGLDPVQGQKLGQGPGHCRGLAETIADYLGEEKKEWL
LENDGWEGFCEFSRSARETSQDSSMKTALFAAAGVGLAGLTFLLIRVQA
>gnl|bcl2dbpro|A0A2K5TKG9_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L10 (length=194 residues).
MADPLRERTERLLADYLGCCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSAYRGYPGNRVELVALMAEAVLSDSP
GPTWGRVVSLVTFAGTLLEREPLVTAWWKKRGFQPRLKEQEGDVARDCQRLVALLSSRLAGQHRAWLQAQGGWDGFCHFF
RSPFPLAFWRKLLIQAFLACLLATAFGYLWTRLL
>gnl|bcl2dbpro|F7H6U5_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L10 (length=194 residues).
MADPLRERTERLLADYLGCCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSAYRGYPGNRVELVALMAEAVLSDSP
GPTWGRVVSLVTFAGTLLEREPLVTAWWKKRGFQPRLKEQEGDVARDCQRLVALLSSRLAGQHRAWLQAQGGWDGFCHFF
RSPFPLAFWRKLLIQAFLACLLATAFGYLWTRLL
>gnl|bcl2dbpro|A0A2K6B2D9_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Macaca nemestrina GN=BCL2L10 (length=194 residues).
MADPLRERTERLLADYLGCCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSAYRGYPGNRVELVALMAEAVLSDSP
GPTWGRVVSLVTFAGTLLEREPLVTAWWKKRGFQPRLKEQEGDVARDCQRLVALLSSRLAGQHRAWLQAQGGWDGFCHFF
RSPFPLAFWRKLLIQAFLACLLATAFGYLWTRLL
>gnl|bcl2dbpro|A0A3Q3KZW1_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Mastacembelus armatus GN=BCL2L10 (length=194 residues).
MSCGLWKETLALAEDYLSLCCTSPQSVPPPPSESAAAMRCLAQKMERQHQARFHSLTQTFLKQCGPDPCSSLRKVIEELV
ADGHLNWGRVVSLFTFTGVLSRQLMEQKGMKPGLDSGKGQELGQGPESCRGLAETIADYLGEEKKDWLQENDGWEGFCKF
SHSAREVSHDSSMKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3P9BLI0_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Maylandia zebra GN=BCL2L10 (length=273 residues).
MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTHSASAEGKTQLYRRSPSAVCMCREQSDIAGR
KMKFCGLWKETLVLAEDYLSFCCTSPHQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPDHCLSLRKVMKE
LVGDGHLNWGRVVSLFAFTGVLARKILEQKPGLDPRQQQELGQEPMSCRRLAETIADYLGEEKKDWLLDNDGWEGFCKFS
RSAREVSQDSSMKKALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3Q3VI28_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Mola mola GN=BCL2L10 (length=196 residues).
MSCGLWKETLALAQDYLSLCCTSQRPAPPPPSESAAAMRDLAQDMEKQHQARFHSLAQTFLRQCGTDPCSSLRNVMEELV
GDGHLNWGRVVSIFTFTGVLARQLLEQKSTKPGLEPRQDQDQELGQVPGNCSELAETIADYLGEEKKAWLLENDGWEGFC
KFSHSAREARLDSSMKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|F6VJQ0_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Monodelphis domestica GN=BCL2L10 (length=189 residues).
MDYKCALREETARLVTDYLEYCCRREGVQELPAPTPAAATLRLVSSELRQIYQDFFECALNQLLDREPEQVIVNVAELMD
RGEFNWGRVAVLVVFAGALLEMEELLKEEQVLQLRRETSRRLTEKLCNYLVERKGAWLHENGGWTGFHHHFEKRQSPPPS
DSSNNTLCCIMAAAAGFGLVGLALLLVVR
>gnl|bcl2dbpro|A0A3Q3JQ78_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Monopterus albus GN=BCL2L10 (length=219 residues).
MCREHLDIAGRKMSCGLWKDTLALAEDYLSLCCTSSRPAPPPPSESAAAMRCLAQDMETQHQARFHSLAQTFLKQCGPDP
CSSLRKVMEELVGDGHLNWGRVVSLFAFTGVLARQLTEQNGMKPGLDPGQGQELGQGPGNCRELAETIADYLGEEKKDWL
LENDGWEGFCKFSRSAREVSHDSSVKTALFAAAGVGLAGLTFLLETSGTCEREQFRKSD
>gnl|bcl2dbpro|Q9Z0F3_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Mus musculus GN=BCL2L10 (length=191 residues).
MADSQDPLHERTRRLLSDYIFFCAREPDTPEPPPTSVEAALLRSVTRQIQQEHQEFFSSFCESRGNRLELVKQMADKLLS
KDQDFSWSQLVMLLAFAGTLMNQGPYMAVKQKRDLGNRVIVTRDCCLIVNFLYNLLMGRRHRARLEALGGWDGFCRFFKN
PLPLGFWRRLLIQAFLSGFFATAIFFIWKRL
>gnl|bcl2dbpro|M3Y8D1_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Mustela putorius furo GN=BCL2L10 (length=226 residues).
MGVAAPPWAEAQRDLENRVGSGSAGRGRAMADALRERTAQLLTDYLEYCARGPGTPARSPSTREAAVLRSVAAVVRQRHE
RFLSDYRGYGGNRVELVAQLEREILAHPQALSWGRVVALVTFAGTLLERPPSGACSNLGPDPELELELGEWEASVRQDCR
RLVDFLCGRLTGQHRAWLEAHGGWDGFCLFFTPALLSWKRLLVQALLSCFTAVILIYFWKRLPFIG
>gnl|bcl2dbpro|G1QEX2_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Myotis lucifugus GN=BCL2L10 (length=179 residues).
DELKLRTRRLLTEFLEHRTRRRGTAPQQPSTPEATVMRSLAAHSWLGTPHSWSRRQRNRLEQMVDQIESLVPDGTDPNWL
SVVALVSFAGALLERPPPGHSQARREWDATVDQDCQRLVTFLCSWLTETHRTWMEAQGGWDGFCHNFMPAPPPGDRLLAP
LLRACLVLIILICLWIKIM
>gnl|bcl2dbpro|A0A3Q4MN81_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Neolamprologus brichardi GN=BCL2L10 (length=204 residues).
MCREQSDIAGRKMKFCGLWKETLVLAEDYLSFCCTSPHQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPD
HCLSLRKVMKELVGDGHLNWGRVVSLFAFTGVLARKILEQKPGLDPGQQQELGQEPMSCRRLAETIADYLGEEKKDWLLD
NDGWEGFCKFSRSAREVSQDSSMKKALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|G1R3W6_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2L10 (length=231 residues).
MVDQLRERTERLLADYLGCCAREPGTPEPTPSTPEAAMLRSAAARLRQLHPSFFSAYLGYPGNRVELVVLMADSVLSDSP
GPTWGRVVTLVAFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLVGQHRAWLQAQGGWVSTRRTP
GHGAGRAAGKRPRGRHGWLLSLLQDPLSAGFLEKTAGPGFSVMLVNNSLHLFLDTIIMSFKTFNPLLPAQL
>gnl|bcl2dbpro|I3J363_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Oreochromis niloticus GN=BCL2L10 (length=235 residues).
MSRGGVTHSLSAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLLLAEDYLSFCCTSPHQAPPPPSESAAAMRR
LGWDIERQHQARFDNLAQTFLVQCGPDHCLSLRKVMKELVGDGHLNWGRVVSLFAFTGVLARKILEQKPGLDPGQQQELG
QEPMSCRRLAETIADYLGEEKKDWLLDNDGWEGFCKFSRSAREVSQDSSMKKALFAAAGVGLAGLTFLLVKGFRF
>gnl|bcl2dbpro|G1T264_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Oryctolagus cuniculus GN=BCL2L10 (length=191 residues).
RPQRRLAMADALEERTARLLTDYLECCAREPGTPEPQPSTPEAAVLRCAATQLQRVHWPFFSVYRGYPGNRIELAARVAE
AVLSDGHDLSWGRVVTLVTFAGTLLDRGPPVTTQRVRRNEIARDCQRLVALLCARLAGQHRAWLQAQGGWDGFCVFYRTP
LPLTFWRRLLVRTFLSCFVATALLFAWTRVY
>gnl|bcl2dbpro|A0A3P9LM07_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L10 (length=192 residues).
MSCGLRKETLAVALDYLSLSCRSPLQAPPPPSESAAAMRRLAQDMEAQYQPRFSTLAQNFRKHSGPDLCSSLRKVMEELV
GDERLNWGRVVSLFAFVGVLARQLREQTDMNPGLDPGREVAPGPVSCQALAETVADFLGGDKKEWMLENDGWEGFCKFSR
TAREVSQDSSMKTALFAAASVGLAGLTFLLVR
>gnl|bcl2dbpro|H2MBQ3_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L10 (length=192 residues).
MSCGLRKETLAVALDYLSLSCRSPLQAPPPPSESAAAMRRLAQDMEAQYQPRFSTLAQNFRKHSGPDLCSSLRKVMEELV
GDERLNWGRVVSLFAFVGVLARQLREQTDMNPGLDPGREVAPGPVSCQALAETVADFLGGDKKEWMLENDGWEGFCKFSR
TAREVSQDSSMKTALFAAASVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3B3C5I4_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Oryzias melastigma GN=BCL2L10 (length=201 residues).
MDGFSAQKMSCGLRKETLAVALDYLSLSCRSPVLQAPPPPSESASAMRRLAQDMETQYQPRFSTLAQDFRKHCGPDLCSS
LRKVMEELVGDEHLNWGRVVSLFAFVGVLARQLREQTDTNPGLDLGREAAPGPVSCQALAETVADFLGGDKKEWMLENDG
WEGFCKFSRTAREVSQDSSMKTALFAAASVGLAGLTFLLVR
>gnl|bcl2dbpro|H0WZ06_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Otolemur garnettii GN=BCL2L10 (length=192 residues).
MADPLRERTERLLTDYLEYCARDPTAPEPTPSSPEAALLRSVTAYIQQRHWSFFSAYIGYPGNRVQVVERMVKAMLSDNQ
RLNWGRVVTLVTFAGTLLQRPPVEARREKQDKSQLKEGEDEVARDCQRLVALLSSRLVGQHRVWLEAQGGWDGFCQFFRT
PLPLAFWRRLLFEVLLLCFLATVFIYFWTRLT
>gnl|bcl2dbpro|W5QIG4_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Ovis aries GN=BCL2L10 (length=193 residues).
GRPPGRGGAMVDPFRERTARLLMDWLEFCAREPGTPAPAPSTPEAAVLRHVAARVLEANRNVLPLYRRYRRHRVELVARM
AQRLLDEDPGPSWGRVASLVTFAGSLLERQPQTTRRQKRDDGSVSRDCRLLVALLCAQFCERHRAWLMANGGWDGFCLSF
SHSLQPSWERQLVWFFLSYWTAIIIIYFWIKLS
>gnl|bcl2dbpro|A0A2R9BCD9_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Pan paniscus GN=BCL2L10 (length=204 residues).
MVDQWRERTTMADPLRERTERLLADYLGYCAREPGTPEPTPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVAL
MADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTTRWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLVGQHRAWLQAQ
GGWDGFCHFFRTPFPLAFWRKQLVQAFLSCLLTTAFIYLWTRLL
>gnl|bcl2dbpro|H2Q9G4_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Pan troglodytes GN=BCL2L10 (length=204 residues).
MVDQWRERTTMADPLRERTERLLADYLGYCAREPGTPEPTPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVAL
MADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTTRWKKWGFQPRLNEQEGDVARDCQRLVALLSSRLVGQHRAWLQAQ
GGWDGFCHFFRTPFPLAFWRKQLVQAFLSCLLTTAFIYLWTRLL
>gnl|bcl2dbpro|A0A096NM44_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Papio anubis GN=BCL2L10 (length=231 residues).
MADPLRERTERLLADYLGCCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSAYRGYPGNRVELVALMAEAVLSDSP
GPTWGRVVSLVTFAGTLLEREPLVTAWWKKRSFQPRLKEQEGDVARDCQRLVALLSSRLAGQHRAWLQAQGGWVSTRRTP
GRGAGRASGKRPRGRHGWLLSLLQEPLSAGFLEKTADPGFPGMLVSNSLRLSLDTIIMSFNIFNPLLPAQL
>gnl|bcl2dbpro|A0A3B4AAV4_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Periophthalmus magnuspinnatus GN=BCL2L10 (length=194 residues).
MSCGLWKETLALAEDYLSLCCSGPQAAPPPPSGSASAMRRLGQDMEAQHKARFHSLSQTFLKQCGPDPCSSLRKVMEELV
GDGHLNWGRVVSLFTFAGVLARHIKEQKSSRPGLDPGQVQGLGQVPSDCRRLAQTIADYLGEEKRDWLLENGGWVGFCEF
SCHARKVDQDSSMKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A096ME02_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Poecilia formosa GN=BCL2L10 (length=216 residues).
MHRGSPSAVWMCREPSHIAGRKMSCGLWKETVAVAEDYIHLRCSSPHPAPPPPSEPAAAMRRLAQDVEAQHQARFHSLAQ
GFLKHCGTDLCSNLRKVMDEMVGDGHFNWGRVVSLFAFAGVLARQLREQTGKNPGPDSGKQQELQQEPVSCRALAETIAD
YLEKHKKDWLQENNGWDGFCSYAHNAREVSQDSSMKTALVAVAGVGIAGLTFLLVR
>gnl|bcl2dbpro|A0A3B3TYN4_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Poecilia latipinna GN=BCL2L10 (length=216 residues).
MHRGSPSAVWMCREPSHIAGRKMSCGLWKETVAVAEDYIRLCCSSPHPAPPPPSEPAAAMRRLAQDVEAQHQARFHSLAQ
GFLKHCGTDLCSNLRKVMDEMVGDGHFNWGRVVSLFAFAGVLARQLREQTGKNPGPDSGKQQELQQEPVSCRALAETIAD
YLEKHKKDWLQENNGWDGFCSYAHNAREVSQDSSMKTALVAVAGVGIAGLTFLLVR
>gnl|bcl2dbpro|A0A3B3YT99_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Poecilia mexicana GN=BCL2L10 (length=216 residues).
MHRGSPSAVWMCREPSHIAGRKMSCGLWKETVAVAEDYIHLRCSSPHPAPPPPSEPAAAMRRLAQDVEAQHQARFHSLAQ
GFLKHCGTDLCSNLRKVMDEMVGDGHFNWGRVVSLFAFAGVLARQLREQTGKNPGPDSGKQQELQQEPVSCRALAETIAD
YLEKHKKDWLQENNGWDGFCSYAHNAREVSQDSSMKTALVAVAGVGIAGLTFLLVR
>gnl|bcl2dbpro|A0A3P9NE65_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Poecilia reticulata GN=BCL2L10 (length=216 residues).
MRRGSPSAVWMCREPSHIAGRKMSCGLWKETVAVAEDYIHLRCSNPHPAPPPPSEPAAAMRRLAQDVEAQHQARFHSLAQ
GFLKHCGTDLCSNLRKVMDEMVGDGHFNWGRVVSLFAFAGVLARQLREQTGKNPGPDSGKQQELQQETVSCRALAETIAD
YLEKHKKDWLQENNGWDGFCSYALNAREVSQDSSMKTALVAVAGVGIAGLTFLLVR
>gnl|bcl2dbpro|H2NN92_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Pongo abelii GN=BCL2L10 (length=204 residues).
MVDQLRERTITADLLRERTERLLADYLGCCAREPGTPEPTPPTPEAAVLRSAAARLRQLHRSFFSAYLGYPGNRVELVAL
MADSVLSDSPSPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLVGQHRAWLQAQ
GGWDGFCHFFRTPLPLAFWRKQLVQAFLSCLLTTAFIYLWTRLL
>gnl|bcl2dbpro|A0A2K6F2Q2_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Propithecus coquereli GN=BCL2L10 (length=192 residues).
MGDRFRERTERLLADYLEYCTREPGAPGLPPSSLEAAAMRFAATKIRRKHASFFSAYVGYPGNRVYLLERMAEAVLCDSL
SWGRVVMLVTFAGTLLERGPPVTAWWKKWGLQPQPKEGDPEVARDRQRLVALLCARLAGQHRAWLQAQGGWDGFCDLFRK
PLPLAVWRRLLVQVLLSCFLATTVIYFWTRLL
>gnl|bcl2dbpro|A0A3B4ETX9_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Pundamilia nyererei GN=BCL2L10 (length=204 residues).
MCREQSDIAGRKMKFCGLWKETLVLAEDYLSFCCTSPHQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPD
HCLSLRKVMKELVGDGHLNWGRVVSLFAFTGVLARKILEQKPGLDPGQQQELGQEPMSCRRLAETIADYLGEEKKDWLLD
NDGWEGFCKFSRSAREVSQDSSMKKALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|Q99M66_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Rattus norvegicus GN=BCL2L10 (length=185 residues).
MGDPLQDRTRRLLTDYILFCARAPNTPEPLPTSVEAALLRSVTSQIQQEHQDLFNSFRDYQGNRLELVTQMADELLSNDQ
EFNWGRLVMLLAFVGTLMNQDRTVKRRRDQRNRLLLERDCYLIVSLLYNRLTGRHRSWLEAHGGWDGFCQFFKNPLPPGF
WRRLLIRAILSCFFATAIFYIWKCL
>gnl|bcl2dbpro|A0A2K6M5H5_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2L10 (length=204 residues).
MADPLRERTTVADPLRERTERLLADYLGCCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSAYLGYPGNRVELVAL
MAEAVLSDSPGPTWGRVVSLVTFAGTLLEREPLVTAWWKKRSFQPRLKEQEGDVARDCQRLVALLSSRLTGQHRAWLQAQ
GGWDGFCHFFRTPFPLAFWRKLLIQAFLACLLTTAFGYLWTRLL
>gnl|bcl2dbpro|A0A2K6R5T5_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L10 (length=231 residues).
MADPLRERTERLLADYLGCCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSAYLGYPGNRVELVALMAEAVLSDSP
GPTWGRVVSLVTFAGTLLEREPLVTAWWKKRSFQPRLKEQEGEVARDCQRLVALLSSRLTGQHRAWLQAQGGWVSTRRTP
GRGAGRASGKRPRGRHGWLLSLLQDPLSAGFLEKTADPGFPGMLVNNSLRLPLDTIIMSFKIFNPLLPAQL
>gnl|bcl2dbpro|A0A2K6TIT7_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L10 (length=228 residues).
MADPLQQRTEQLVADYLEYCSREPGTPESPPATAEAAVLRATAAVVRKLYPSFFSAYRGYPRNRVELVARMAEALLSDSP
GPTWGNVVMLLAFAGTLLERGPLVTARWKKWGFQSRLKEPEGDVARDCQRLVGLLSSRLVGQHRAWLEAQGGWVSTRRRT
WGGMGTWEGPARWGIFLLCLLNDLLLAGMEKTAGPGFPVMVVNSSIHLLLDTIIRSFKIFSPLLPAQL
>gnl|bcl2dbpro|A0A3B4TIY6_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Seriola dumerili GN=BCL2L10 (length=190 residues).
MSCGLWKETRAVAEDYLYLCCTSPQPAPPPPSESAAAMRSMAQDMETQHQARFHTLAQTFVTQCGLDPCSSLRKVMEELV
GDGHLNWGRVVSIFTFTGVLARLLLEQNRVNPGLDPGQGQGLGNCRGLAETIADYLGEEKKDWLLENGGWEGFCKFSHSA
REVSQDLSMKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3B4WGF4_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Seriola lalandi dorsalis GN=BCL2L10 (length=190 residues).
MSCGLWKETRAVAEDYLFLCCTSPQPAPPPPSESAAAMRGMAQDMETQHQARFHTLAQTFVTQCGLDPCSSLRKVMEELV
GDGHLNWGRVVSIFTFTGVLARLLLEQNRVNPGLDPGQGQGLRNCRGLAETIADYLGEEKKDWLLENGGWEGFCKFSHSA
REVSQDLSMKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3B4ZFS0_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Stegastes partitus GN=BCL2L10 (length=194 residues).
MSCGLWKETLVVAEDYLSLCCTSPHSAPPPPSESAAAMRCLAQDMEKQHQARFHSLTQTFLRQPGPDLCSSLRRVMEELV
GDGHLNWGRVVSLFTFTGVLARQLQEQRDTKPGLEPGKRQELGQGPVNCRGLAETIADYLGEEKKDWLLENDGWEGFVKF
SLSAREVSQDLSMKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|F1RZB9_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Sus scrofa GN=BCL2L10 (length=184 residues).
MADAFRERTARLLTDYLEYCAREPGTAARQPSSPEAAVLRCVAAQIREYNVRTLSVYRGFRWNRVELVAWMAQKLLASPR
GPNWYRVASLLTFAGMLLERHPREACGRKKKEGNVSRDCRLLVALLCAQLSGQHRTWLLANGGWDGFCLFFQGSLQQTWT
RHMVWVFVSYCTAVVLLYLWRKLL
>gnl|bcl2dbpro|A0A3B5KD08_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Takifugu rubripes GN=BCL2L10 (length=194 residues).
MSCGLWKETLALAEDYLSLCSTSQCPAPPPPSESATAMRHLGQDMEKQHQARFNSLAQTFLRQCGPDLCSSLRKVMEELV
GDGHLNWGRVVSLFTFTGVLARLMQEQKSTKPGLDPGQEQQLGQVPENCRGLAETIADYLGEEKKDWLLENGGWEGFCKY
SLAAREVNHDSSMKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A452QJG0_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Ursus americanus GN=BCL2L10 (length=197 residues).
MADALRERTARLLTDYLEYCAREPGTPARAPSTPEAAVLRSVAAQVQQRHEHFLSDYRGYGGNRVELVAQVEREILAHPQ
PLSWGRVVALLTFAGTLLERSPSGTYSNLGPDQELELGEREAGVRQDCRHLVDFLCNRLTGQHRAWLEAHDGWVNGFCLF
FTPMLAVRLGKDCWPRLFCPASQAVILIYFWKRLCEF
>gnl|bcl2dbpro|A0A3B5MJ12_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Xiphophorus couchianus GN=BCL2L10 (length=194 residues).
MSCGLWKETVVVAEDYIRLRCSSPHPAPPPPSEPAAAMRRLAQDVEAKHQARFHSLAQGFLKHCGSDLCSNLRKVMDEMV
GDGHFNWGRVVSLFAFAGVLARQLREQTGKNPVPDSGKQQELQQEPVSCRALAETIADYLEKHKKDWLQENNGWEGFCSY
ARNAREASQDSSMKTALVAVAGVGIAGLTFLLVR
>gnl|bcl2dbpro|M4AUW7_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Xiphophorus maculatus GN=BCL2L10 (length=194 residues).
MSCGLWKETVVVAEDYIRLRCSSPHPAPPPPSEPAAAMRRLAQDVEAKHQARFHSLAQGFLKHCGSDLCSNLRKVMDEMV
GDGHFNWGRVVSLFAFAGVLARQLREQTGKNPVPDSGKQQELQQEPVSCRALAETIADYLEKHKKDWLQENNGWEGFCSY
ARNAREASQDSSMKTALVAVAGVGIAGLTFLLVR
© 1998-2019