Dataset for protein Bcl-xL of organism all

[Download (right click)] [Alignment] [Repertoires]

200 sequence(s)

>gnl|bcl2dbpro|A0A3Q1EVP6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Acanthochromis polyacanthus GN=BCL2L1 (length=208 residues).
MSCSNRELVEFFISYKLSQRNYPMSLLRPEDAGGRTDGDKASSASSNGLLVNNRDGIEAVKSTLKDAADEFELLFTQTFS
DLSSQIDITPETAYHSFKSVMDEVFKDGVNWGRIVGLFCFGGVLCVECVEKNMSELVPRIADWMTMYLDEHISPWIQSQG
DWECFAEIFGQNAAAEARRSRDTLKRWLLAGGVLLMGVLAGVLIAKKQ
>gnl|bcl2dbpro|A0A3Q1GS47_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Acanthochromis polyacanthus GN=BCL2L1 (length=229 residues).
MSQNRELVVFYIKYKLSQRNYPLNHMVLNEAPNRTDGGEARLGEDQRTETHANGTFNGTSPGTPPPSPRRLASTATMDAV
KEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRI
VEWMTVYLDNHIQDWIQGQGGWERFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q1GS47_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Acanthochromis polyacanthus GN=BCL2L1 (length=368 residues).
MFRRHVKASYYVIGRQGRADVGGYVRAHTLVNTKWMCDILVELDSFLCAPSDRRTGDSVTERRTASRESRAFVSVLAGPE
LVCQPCVGLVFTPERPVDISGPWWSEQRAAGRQPGTVCVHSNAARRTRATRTENTLARNMSQNRELVVFYIKYKLSQRNY
PLNHMVLNEAPNRTDGGEARLGEDQRTETHANGTFNGTSPGTPPPSPRRLASTATMDAVKEALRDTANEFELRYARAFSD
LHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRIVEWMTVYLDNHIQDWIQGQGG
WERFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q0RTF8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Amphilophus citrinellus GN=BCL2L1 (length=232 residues).
MSQNRELVLFYITYKLSQRNYPLNHIVLNEPSNRTDGGAAGLDEEQRIDTHANGTFNGTSPGTPPASPQRQQQPPSTTNL
DAVKEALRDTANEFELRYARAFNDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLV
GRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVAGALIAQKRL
>gnl|bcl2dbpro|A0A3Q1BQA0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Amphiprion ocellaris GN=BCL2L1 (length=208 residues).
MSYSNRELVEFFVSDKLSQRNYPTSLLRPEDAGGRTDGDKANSASSNGLLVNSRGGIEAVKSALKDAADEFELLFTQAFS
DLSSQLDITPETAYHSFKSVMDEVFKDGVNWGRIVGLFCFGGVLCVECVEKNMSELVPRIADWMTMYLDEHISPWIQSQG
GWECFAEIFGQNAAAEARRSRDTLKRWLLVGGVLLMGVLAGVLIAKKQ
>gnl|bcl2dbpro|A0A3Q1DHJ3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Amphiprion ocellaris GN=BCL2L1 (length=229 residues).
MSQNRELVVFYIKYKLSQRNYPLNHMVLNEAPSRTDGGEARLGEEQRTETHANGTFNGTSPGTPPPSPRRLASTATMDAV
KEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRI
VEWMTVYLDNHIQDWIQSQGGWERFAEIFGQDAAAESRKSQESFKKWLLVGMTVVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q1DHJ3_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Amphiprion ocellaris GN=BCL2L1 (length=229 residues).
MSQNRELVVFYIKYKLSQRNYPLNHMVLNEAPSRTDGGEARLGEEQRTETHANGTFNGTSPGTPPPSPRRLASTATMDAV
KEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRI
VEWMTVYLDNHIQDWIQSQGGWERFAEIFGQDAAAESRKSQESFKKWLLVGMTVVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q1DHJ3_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Amphiprion ocellaris GN=BCL2L1 (length=229 residues).
MSQNRELVVFYIKYKLSQRNYPLNHMVLNEAPSRTDGGEARLGEEQRTETHANGTFNGTSPGTPPPSPRRLASTATMDAV
KEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRI
VEWMTVYLDNHIQDWIQSQGGWERFAEIFGQDAAAESRKSQESFKKWLLVGMTVVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3P8TL99_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Amphiprion percula GN=BCL2L1 (length=229 residues).
MSQNRELVVFYIKYKLSQRNYPLNHMVLNEAPSRTDGGEARLGEEQRTETHANGTFNGTSPGTPPPSPRRLASTATMDAV
KEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRI
VEWMTVYLDNHIQDWIQSQGGWERFAEIFGQDAAAESRKSQESFKKWLLVGMTVVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3P8TL99_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Amphiprion percula GN=BCL2L1 (length=229 residues).
MSQNRELVVFYIKYKLSQRNYPLNHMVLNEAPSRTDGGEARLGEEQRTETHANGTFNGTSPGTPPPSPRRLASTATMDAV
KEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRI
VEWMTVYLDNHIQDWIQSQGGWERFAEIFGQDAAAESRKSQESFKKWLLVGMTVVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3P8U812_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Amphiprion percula GN=BCL2L1 (length=208 residues).
MSYSNRELVEFFVSYKLSQRNYPTSLLRPEDAEGRTDGDKANSASSNGLLVNSRGGIEAVKSALKDAADEFELLFTQAFS
DLSSQLDITPETAYHSFKSVMDEVFKDGVNWGRIVGLFCFGGVLCVECVDKNMSELVPRIADWMTMYLDEHISPWIQSQG
GWECFAEIFGQNAAAEARRSRDTLKRWLLVGGVLLMGVLAGVLIAKKQ
>gnl|bcl2dbpro|A0A3Q1GZ93_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Anabas testudineus GN=BCL2L1 (length=232 residues).
MSQNRELVVFYITYKLSQRNYPLNHLGLNETPNRTDGGEDGLSEEQRIATHANGTFNGRSPGTPPASPLRQQRLPSTTSL
DAVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSQLV
GRIVEWMTVYLDNHIQPWIQSQGGWERFAELFGHDAAAEGRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q1GZ93_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Anabas testudineus GN=BCL2L1 (length=232 residues).
MSQNRELVVFYITYKLSQRNYPLNHLGLNETPNRTDGGEDGLSEEQRIATHANGTFNGRSPGTPPASPLRQQRLPSTTSL
DAVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSQLV
GRIVEWMTVYLDNHIQPWIQSQGGWERFAELFGHDAAAEGRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q1GZ93_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Anabas testudineus GN=BCL2L1 (length=232 residues).
MSQNRELVVFYITYKLSQRNYPLNHLGLNETPNRTDGGEDGLSEEQRIATHANGTFNGRSPGTPPASPLRQQRLPSTTSL
DAVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSQLV
GRIVEWMTVYLDNHIQPWIQSQGGWERFAELFGHDAAAEGRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q1JZ46_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Anabas testudineus GN=BCL2L1 (length=219 residues).
MEEMSNSNRELVEFFIMYKLSQRNHPASLLRPDDTGGVGDRPNSAAANGLPVSRSGELGNSSPPCKSMEAVKTALRDSAD
EFELLFTQAFSDLSSQLDVTPDTAYQSFKSVMDELFKDGVNWGRIVGLFAFGGVLCVECVEKNMSELVSRIADWMTMYLD
EHISPWIQSQGGWDCFAEIFGQDAAAEARRSREALRRWLLVGVVLLTGVLLGVLIAKKR
>gnl|bcl2dbpro|A0A3Q1JZ46_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Anabas testudineus GN=BCL2L1 (length=219 residues).
MEEMSNSNRELVEFFIMYKLSQRNHPASLLRPDDTGGVGDRPNSAAANGLPVSRSGELGNSSPPCKSMEAVKTALRDSAD
EFELLFTQAFSDLSSQLDVTPDTAYQSFKSVMDELFKDGVNWGRIVGLFAFGGVLCVECVEKNMSELVSRIADWMTMYLD
EHISPWIQSQGGWDCFAEIFGQDAAAEARRSREALRRWLLVGVVLLTGVLLGVLIAKKR
>gnl|bcl2dbpro|H9GHK7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Anolis carolinensis GN=BCL2L1 (length=209 residues).
MSSSNRALVVDFLSYKLSQRGHSWHEIEMESGEEAMEPANETGNTLNGSPSWHPSPSHVINGASEHPELLEEEEEENPRV
DVSQTLREAGDEFELRYRRAFSDLTSQLHITLGTAYQSFEQVVNELFHDGVNWGRIVAFFSFGGALCVESVDKEMQGLVV
RIASWMTTYLTEHLDPWIQENGGWKSKGGQIISVIYTHHSEVCLNTYID
>gnl|bcl2dbpro|A0A2K5EBP4_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2L1 (length=146 residues).
MWKRTGLRPQKGLIRRWRPPVPSMLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIA
AWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K5EBP4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTDSEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|E2IV75_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Aotus vociferans GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTDSEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A3P8P0F1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Astatotilapia calliptera GN=BCL2L1 (length=233 residues).
MSQNRELVLFYIRYKLSQRNYPLNHIVLNEPSNRTDGGAAGLDEEQRIDTHANGTFNGTSPGTPPASPQRRQQQPPSTTD
LDAVKEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPL
VGRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVAGALIAQKRL
>gnl|bcl2dbpro|A0A3B1JJ42_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Astyanax mexicanus GN=BCL2L1 (length=239 residues).
VMSYYNRELVVYFIKYKLSQRNYPTNHIGLMEETNRTEGGQEAEGNAEAAGVTPTAVVNGSVNGTSHGAAGSPTSSPQRR
ANGARGLDAVKEALRDSANEFELRYSRAFSDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVE
KEMSPLVGRIAEWMTVYLDNHIQPWIQEQGGWERFAEIFGNDTAAESRRMQERYKMWLLVGMTLFTGIVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q1LRT3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Bos taurus GN=BCL2L1 (length=237 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSVRYGNPQWISGNPSWHLADSPTVNGATGHSRSLDARKMIPMTTVKQALREAS
NEFKLRYQQTFSDLMSQLRITPGTACQSFEQVINELFRDRVKWGHVVAFFSFSGTLCMKSIDKEIHVLVSQVTTSTATYL
NNHLKPWIQENGGWDTFVELYESNTTNESQKGQERFNCWSLTTRLWLFGIFLIKHIFTKQPSNCTLEHLSGRYATLL
>gnl|bcl2dbpro|Q05KJ0_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Bos taurus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNASWHLADSPAVNGATGHSRSSDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|Q05KJ0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Bos taurus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNASWHLADSPAVNGATGHSRSSDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|F7IT34_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTDSEMETPSAINGNPSWHLADSPVVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|F7IT34_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTDSEMETPSAINGNPSWHLADSPVVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|Q76LT7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A452E1B1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Capra hircus GN=BCL2L1 (length=232 residues).
MSQSNRELVVDFLSYKFFQKGYSWSQFSDMEENRTETLEGTESDMETPSAISGNPSWHLADSSVVNGATGHSRSLDAGKM
IPTAVVKQALREASNECELRYQQTFSDLTSQLHITPGTTYQSFEQVINELFQDGVNWCRNVAFFSFGGALCMKSIVKEMQ
VLVSQVTTWMATYLNNHLEPWIQENGDWDIFVELYENNTATESQKGQEHFNRWSLTDVTVAGMALLGLLFNT
>gnl|bcl2dbpro|A0A452FIG6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Capra hircus GN=BCL2L1 (length=232 residues).
MSQSNRELVVDFLSYKLSQKGFSWSLRRDKIRYGNPNAVNANPSWHLAHSPAVNGATGHTEESGPVATAQQAPREAGSEF
ELRHQQTVSDLTSQLHTTPGTAYQSFEQVMYELFWDGVNWDHTVAFFSFRGALCMESVDKEMQVLVSQVMTWMASQLNDH
LEPWIQENGGWDTSVEFCENNTATESQKGQERFNCWSLTAVTLAGGSGLSRKAAVSKDTPWLTFPSPHAQAY
>gnl|bcl2dbpro|A0A452FIG6_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Capra hircus GN=BCL2L1 (length=240 residues).
MSQSNRELVVDFLSYKLSQKGFSWSLRRDKIRYGNPNAVNANPSWHLAHSPAVNGATGHTEESGPVATAQQAPREAGSEF
ELRHQQTVSDLTSQLHTTPGTAYQSFEQVMYELFWDGVNWDHTVAFFSFRGALCMESVDKEMQVLVSQVMTWMASQLNDH
LEPWIQENGGWDTSVEFCENNTATESQKGQERFNCWSLTAVTLAGLALQLIVTVPFITVIHVLHKLVFPSFCYSYRDLTI
>gnl|bcl2dbpro|A0A452FWV3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Capra hircus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNPSWHLADSPAVNGATGHSRSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A1L5BWY3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Castor fiber GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGIESEVETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREV
IPMTAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A286Y5D6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cavia porcellus GN=BCL2L1 (length=233 residues).
MSQSNWELVVDFLSYKLSQKGYSWSQFSDVEENRTEGPEGTESEMETPSAINGNPSWHLTDSPTVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVRRIASWMATYLNDHLEPWIQDNGGWDTFVELYGNNAAAESRKGQERFNRWLLTGVTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K5M8B1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cercocebus atys GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K5M8B1_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Cercocebus atys GN=BCL2L1 (length=145 residues).
MWKRTGLRPQKGLNRRWRPPVPSMATHPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAA
WMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A0D6DR75_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Channa striata GN=BCL2L1 (length=232 residues).
MSQNRELVVYYITYKLSEKNYPLNHLGLSEPPNRTDGGEVESAEEQRIATHANGTFNGRSPGTPPASPLRQQRLPSPTSL
DAVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQSFANVMDEVFRDGVNWGRIIGLFAFGGALCVECVEKEMSQLV
VRIVEWMTVYLDDHIQPWIQSQGGWEHFAEIFGHDAAAESRRSQESFKKWLLAGMTVVTGVVAGALIAQKRL
>gnl|bcl2dbpro|A0A0D9RJZ8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Chlorocebus sabaeus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREV
IPMAAVKQTLREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A059PJI5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Clarias batrachus GN=BCL2L1 (length=238 residues).
MSYYNRELVVYFIKYKLSQKNYPCDHIGLTEEVNGQVAEENAVGAGESETPTAVVNGTLNGTGSAGTPPRSPTLSPQRQV
NGSASLEAVKEALRDSGNEFELRYSRAFSDLSSQLHITPVTVYQSFESVMDEVFRDGVNWGRIVGLFAFGGALCVECVEK
EMSPLVARIAEWMTVYLDNHIQPWIEEQGGWERFAEIFGKDAAAEGRRSQESFKKWLLAGVTLFTGVVVGSFIAQKRL
>gnl|bcl2dbpro|A0A2K5H963_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K5H963_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BCL2L1 (length=145 residues).
MWKRTGLRPQKGLNRRWRPPVPSMATHPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAT
WMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|B2Z3Z4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cricetulus griseus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKFSQKGYSWSQFSDVEENRTEAPEGTESERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQDNGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A345BSW9_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Ctenopharyngodon idella GN=BCL2L1 (length=208 residues).
MSYYNRELVVFFIKYKLSQRNYPCNHIGLTEDTNRTDGAEENGEGAAGTTTLVNGSMNRTPPQSPATSPQHQTNGSGGLD
AVKEALRDSANEFELRYSRAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVG
RIAEWMTVYLDNHIQPWIQSQGGWVSGKLLAFLSYLVPFLQFNHKEPL
>gnl|bcl2dbpro|A0A3P8UWG7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cynoglossus semilaevis GN=BCL2L1 (length=235 residues).
TLTFNINRKLVVDYIQYKLSQRNFPVHHLGLGDSPNRTDGEEAGLGAEQRTSTHANGTVNGTSSGTPPASPLRQQHSASD
TSLDSIKEALRDSANEFELRYARAFSDLHQQLHITPATAYQSFENVMDEVFRDGVNWGRIIGLFAFGGALSVECVEKEMS
QLVARIADWMTVYLDNHIQPWIETQGGWEHFAELFGQDAAAESRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3P8VMA1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cynoglossus semilaevis GN=BCL2L1 (length=214 residues).
MSCSNRELVKFFLGYKLSQRNYPESLLMLRIGGEQREGEEVTTASSNGVPQTPSAVLQHCSGAEAVKAALKDSADEFELR
FTQAFRNLFLKLDLTPDTVYHSFKSVMDEVFRDGVNWGRIVGLFTFGGVLCVECVQRNMSELVPRIADWMTMYLDEYIDP
WIQSQGGWDRFAEIFGTDCIPRTRSCRDTVRRWLLVGAGLLAAVLIGVLITKKH
>gnl|bcl2dbpro|A0A3Q2C6K4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cyprinodon variegatus GN=BCL2L1 (length=219 residues).
MSYSNRELVEFYISYKLSQTNCPNSLLRSEVTGGRTEGDKDASASSNGPLFNSRPSPPGKPRAPHGSIEAVKSALKDSAN
EFELLFSQSFSDLSMQLDITPDTAYHSFKAVLDELFKDGINWGRVVGLFAFGGVLCVHCVQKNMSELVSRIADWMTIYLD
EQLNPWIHSQGGWDCFAKLYGQDAAAEGRRSHETLNKWLLVGAALLGGVLLTVLVAKKR
>gnl|bcl2dbpro|A0A3Q2FR43_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cyprinodon variegatus GN=BCL2L1 (length=226 residues).
MSQNRELVLFYIKFKLSQRNYPVNHIMLNEPPNGTGAQGAEQDDERTPETHANGTFNGTSPGSPRRQQASTAAMEAVKAA
LRDTACEFELRYARAFNDLHSTLHITPATAYQSFENVMNEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRIVEW
MTVYLDEQIDPWIQSQGGWERFAEIFGGDAAAESRRSQESLKNWLLLGMSVATALIAGSIFAHKRL
>gnl|bcl2dbpro|Q90Z98_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Danio rerio GN=BCL2L1 (length=238 residues).
MSYYNRELVVFFIKYKLSQRNYPCNHIGLTEDTNRTDGAEENGEGAAGATTLVNGTMNRTNASSTGTPPQSPASSPQRQT
NGSGGLDAVKEALRDSANEFELRYSRAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAFGGALCVECVEK
EMSPLVGRIAEWMTVYLDNHIQPWIQSQGGWERFAEIFGKDAAAESRKSQESFKKWLFAGMTLLTGVVVGGLIAQKRL
>gnl|bcl2dbpro|Q90Z98_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Danio rerio GN=BCL2L1 (length=238 residues).
MSYYNRELVVFFIKYKLSQRNYPCNHIGLTEDTNRTDGAEENGEGAAGATTLVNGTMNRTNASSTGTPPQSPASSPQRQT
NGSGGLDAVKEALRDSANEFELRYSRAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAFGGALCVECVEK
EMSPLVGRIAEWMTVYLDNHIQPWIQSQGGWERFAEIFGKDAAAESRKSQESFKKWLFAGMTLLTGVVVGGLIAQKRL
>gnl|bcl2dbpro|E6ZFR0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Dicentrarchus labrax GN=BCL2L1 (length=220 residues).
MSYSNRELVEFFISYKLSQRNHPTSLLRPENAGERTEGDKANSAARNGLLASKNTSGQPGTSSSSGADIEAVKAALRDSA
DEFELLFTQAFSDLSSQIDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVECVEKDMSELVSRIADWMTMYL
DEHISPWIQSQGGWDCFAEVFGRDAAAEARRSRETLSRWLLIGVALLMGAVVGVLIAKKH
>gnl|bcl2dbpro|A0A219P0Y3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Epinephelus coioides GN=BCL2L1 (length=232 residues).
MCQNRELVVCYIKYKLTQRNYPLNHMGLIEPPNRTDGGEAGLGEEQRVATHANGTFNGMSPGTPPASPLRQQQLPSTTSL
DAVKEALRDSANEFELRYARAFSDLHHQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLV
GRIIEWKTRYLDNHIQPWIQSQRGWERFAEIFGQDAAAESRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|F6WQI0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Equus caballus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYNWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPTGNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|F6WQI0_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Equus caballus GN=BCL2L1 (length=245 residues).
MSQSNRELVVDFLSYKLSQKGYNWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPTGNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWKETALGTFCYFVSSLMRLSGQGGALQLAPSYSAFWADSRAPLGTRGFSLALQ
EMPLQ
>gnl|bcl2dbpro|A0A3P8XFS0_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Esox lucius GN=BCL2L1 (length=208 residues).
MSYSNRELVVFFINYKLSQRNYSCCELELEGASGRTEGEEATANGSVGNGRNSRRNLGKPSTPQGCMEAVKAALRDSADE
FELRYTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSLLVARIADWMTTYLDE
HIQPWIQIQGGWDRFADIFGRDAAADIRRSQESLRKWLLFGMENAQWT
>gnl|bcl2dbpro|A0A3P8XFS0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Esox lucius GN=BCL2L1 (length=219 residues).
MSYSNRELVVFFINYKLSQRNYSCCELELEGASGRTEGEEATANGSVGNGRNSRRNLGKPSTPQGCMEAVKAALRDSADE
FELRYTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSLLVARIADWMTTYLDE
HIQPWIQIQGGWDRFADIFGRDAAADIRRSQESLRKWLLFGVMLLSGVLVGTLLMKKRQ
>gnl|bcl2dbpro|A0A3P8XYL5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Esox lucius GN=BCL2L1 (length=230 residues).
MTYNNKELVAYYITYKLSQRNYPINHTGLTGAFDRTEGGEVEEVAAVTMHPNGTMNGTSPGTPTQQSPPSSPRRTVGLDA
VKEALRDSANEFELRYALAFSDLSSQLHLTPATAYQSFASVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKEMSPLVGR
IADWMTVYLDNHIQPWIESQGGWDRFAEIFGKDAAANSRKSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|M3XA94_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Felis catus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|Q8SQ42_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Felis catus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSRFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERSNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|U3JSL7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Ficedula albicollis GN=BCL2L1 (length=230 residues).
MYSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAGEEDEMDGVLNGSPSWHAPTSHIVNGASVHQSSLEVHEIRRA
ADVRQALREAGDEFELRYRRAFSDLTSQLHITPSTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVVKEMRVLV
KRIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEVRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A3Q2NRP4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Fundulus heteroclitus GN=BCL2L1 (length=219 residues).
MSYSNRELVEFYISYKLSQTNCPNSLLRSEVAGDRTEGDKDSPASSNGPLVSSWAGSPWQPWAPHGRAEAVKSALRDSAD
EFEHLFTQSFSHLSLQLDITPDTAYHSFKAVLDELFKDGVNWGRVVGLFAFGGVLCVDCVQKNMSELVPRIADWMTIYLD
EQLDPWVRSQGGWECFAKLYGQDAAAAGRRFQETLNKWLLVGAALLTGFLLVVLFAKKR
>gnl|bcl2dbpro|A0A3Q2QPL9_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Fundulus heteroclitus GN=BCL2L1 (length=229 residues).
MSQNRELVLSYVKFKLSQRNYPVNHIMLNEPPSDGGARDAESDEEQTAETHANGTVNGTSSGSPRRRQQQPASTAAMEAV
KVALRETACEFELRYARAFNDLHSTLHITPATAYQSFENVMNEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRI
VEWMTVYLDEQIDPWIQSQGGWERFAEIFGGNAAAESRRSQESFKNWLLLGMSVVTAFIAGSIFVQKRL
>gnl|bcl2dbpro|D2ITA2_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Gadus morhua GN=BCL2L1 (length=227 residues).
MSIDTSMSISNRELVFFFLSHKLSQRNYRPIPFQPEGAGEGTDEDKSNRIGNNGLRLNDGNGNGQLAPSPTPQGTEAVRA
ALLESVEEFELRYTLAFSDLSSQLPITPATAYGSFESVMDEVFRDSINWGRIVGLFAFGGALCVECVEKEMSHMVPRVAE
WMTRYLDDHIDHWIQSNGGWKHFAAVFGSDAAAGARRTRDSHRRWMLVGAALLTGVLLGALLAKKHV
>gnl|bcl2dbpro|Q07816_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Gallus gallus GN=BCL2L1 (length=229 residues).
MSSSNRELVIDFVSYKLSQRGHCWSELEEEDENRTDTAAEAEMDSVLNGSPSWHPPAGHVVNGATVHRSSLEVHEIVRAS
DVRQALRDAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFHDGVNWGRIVAFFSFGGALCVESVDKEMRVLVG
RIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNNAAAELRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|Q07816_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Gallus gallus GN=BCL2L1 (length=229 residues).
MSSSNRELVIDFVSYKLSQRGHCWSELEEEDENRTDTAAEAEMDSVLNGSPSWHPPAGHVVNGATVHRSSLEVHEIVRAS
DVRQALRDAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFHDGVNWGRIVAFFSFGGALCVESVDKEMRVLVG
RIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNNAAAELRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|Q07816_BCL2L1-04 BCL2-like 1 protein OS=[Eukaryota] Gallus gallus GN=BCL2L1 (length=229 residues).
MSSSNRELVIDFVSYKLSQRGHCWSELEEEDENRTDTAAEAEMDSVLNGSPSWHPPAGHVVNGATVHRSSLEVHEIVRAS
DVRQALRDAGDEFELRGFVRGERGQGDAGTGGTHCVLDDHVLDRPSRSLDPGEWRLGALCGSVWEQRCCRAEEGPGDLQQ
MAPHRGDRGRSASAGIPAEPQVTPWLCPLAPGWLRLHTSTTQLPSTITITGRSPRSTELPSSRRQLLLS
>gnl|bcl2dbpro|Q07816_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Gallus gallus GN=BCL2L1 (length=229 residues).
MSSSNRELVIDFVSYKLSQRGHCWSELEEEDENRTDTAAEAEMDSVLNGSPSWHPPAGHVVNGATVHRSSLEVHEIVRAS
DVRQALRDAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFHDGVNWGRIVAFFSFGGALCVESVDKEMRVLVG
RIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNNAAAELRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|G3NJY1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Gasterosteus aculeatus GN=BCL2L1 (length=190 residues).
MSQNRELVVFYINYKLSQRNLPLNHIGLSEPPNRTGGGVEAGAAGGQRGATHSNGTFNGTSPGTPPASPLLQQRSPSTAS
LDAVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQSFEDVMDEVFRDGVNWGRIVGLFAFGGALCVECVDKEMSPL
VGRIVEWMTLYLDNHIQPWIQNQGGWRSDI
>gnl|bcl2dbpro|G3P7B4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Gasterosteus aculeatus GN=BCL2L1 (length=220 residues).
MANINRELVEFFLSYKLSQKNHPTSLLRPEDAGGRTEGDKANSASVPGRGSSAGQPGMSSPPPPPSGDTEAVKAALQDSA
NEFELLFTQAFSDLSLQLDVTPDTAYHSFKSVMDEVFKDGVNWGRVVGLFAFGGVLCVECVEKDMTELVSRIADWMTTYL
DEHISAWIQSQGGWDCFADIFGRDGAAAARRSQETMRRWLLVGVALLMGVLVGMVMVKKR
>gnl|bcl2dbpro|A0A452ILL8_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Gopherus agassizii GN=BCL2L1 (length=229 residues).
MSNTNRELVIDFLSYKLSQRGYSWSRFEGEDEIRTDSAEEAEMASVPNGSPSWHPGASHIVNGAAGHSNSLEAHERVPAT
GVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVG
RIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAKSRKGQEQFNRWLLTGATLAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A452ILL8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Gopherus agassizii GN=BCL2L1 (length=229 residues).
MSNTNRELVIDFLSYKLSQRGYSWSRFEGEDEIRTDSAEEAEMASVPNGSPSWHPGASHIVNGAAGHSNSLEAHERVPAT
GVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVG
RIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAKSRKGQEQFNRWLLTGATLAGVLLLGSLLSRK
>gnl|bcl2dbpro|G3RY91_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|G3RY91_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2L1 (length=145 residues).
MWKRTGLRPQKGLNRRWRPPVPSMATHPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAA
WMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A3Q2X557_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Haplochromis burtoni GN=BCL2L1 (length=233 residues).
MSQNRELVLFYIRYKLSQRNYPLNHIVLNEPSNRTDGGAAGLDEEQRIDTHANGTFNGTSPGTPPASPQRRQQQPPSTTD
LDAVKEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPL
VGRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVAGALIAQKRL
>gnl|bcl2dbpro|A0A3Q3DUT7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Hippocampus comes GN=BCL2L1 (length=225 residues).
MSQNRELVLFYIRYKLSQKNYPLNHIGLRQALNRTDGREEASGEEEQRVQTPANGTTNGTSPPASPLREAASLDAVKEAL
RDSANEFELRYSHAFSDLDKQLHITPATAYQSFENVVDEVFQDDVNWGRIVGLFAFGGALCVECMEKEMIPLVDRIIEWM
TVYLDNHLQPWIESQGGWQRFAEIFGHDAAAEVRRSQESFKKWLLAGVTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q3DUT7_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Hippocampus comes GN=BCL2L1 (length=225 residues).
MSQNRELVLFYIRYKLSQKNYPLNHIGLRQALNRTDGREEASGEEEQRVQTPANGTTNGTSPPASPLREAASLDAVKEAL
RDSANEFELRYSHAFSDLDKQLHITPATAYQSFENVVDEVFQDDVNWGRIVGLFAFGGALCVECMEKEMIPLVDRIIEWM
TVYLDNHLQPWIESQGGWQRFAEIFGHDAAAEVRRSQESFKKWLLAGVTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q3DUT7_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Hippocampus comes GN=BCL2L1 (length=225 residues).
MSQNRELVLFYIRYKLSQKNYPLNHIGLRQALNRTDGREEASGEEEQRVQTPANGTTNGTSPPASPLREAASLDAVKEAL
RDSANEFELRYSHAFSDLDKQLHITPATAYQSFENVVDEVFQDDVNWGRIVGLFAFGGALCVECMEKEMIPLVDRIIEWM
TVYLDNHLQPWIESQGGWQRFAEIFGHDAAAEVRRSQESFKKWLLAGVTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|Q07817_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Homo sapiens GN=BCL2L1 (length=170 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGV
VLLGSLFSRK
>gnl|bcl2dbpro|Q07817_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Homo sapiens GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|Q07817_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Homo sapiens GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A287CZ07_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BCL2L1 (length=224 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEVETPSAINGNPSWHLADSPAINGATGHSSSLDAREV
IPMAAVKQALREAGDEFELWYWRAFSDLTSQLHITLGTAYQSFEQVVNELFRDGVNWGHIVAFLSFGGALCMESVDKEMQ
VLVSRIASWMPWIQENGGWDTFVELYRNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|I3MUP5_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEVETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|I3MUP5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEVETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|I3MUP5_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEVETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A3Q3B3X5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Kryptolebias marmoratus GN=BCL2L1 (length=232 residues).
MSQNKELVLFYIMYKLSQRNYPVNHIILSDPPNRTDAGDAGLEDAEMTETHANGTFNGTSPGTPPASPLRQQPLPTTANM
DKVKEALRDTANEFELRYARAFSDLHSQLHITPGTVYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSHLV
ARIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGDNAAAESRISQEGLKKWLLVGMTVVTAVVAGSLFAQKRL
>gnl|bcl2dbpro|A0A3Q3BEB7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Kryptolebias marmoratus GN=BCL2L1 (length=218 residues).
MSHSNRDLVQFYISYKLSQRNCSKSLLMPEVAGERTEKASSAPSNGLLVNSRDGQSGKKIWPRRSDIEAVKSALKDSADE
FERLYTQSFSHLSLQLDISPDTVYHSFKSVLDELFKDGVNWGRVVGLFAFGGVLCVQCVERDMSELVSRIADWMTVYLDE
QIGPWIDSQGGWDSFAEMYGRDAAAEARRFQESLKKWLLAGAALLAGLLLGVLVAKKR
>gnl|bcl2dbpro|A0A3Q3FUB6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Labrus bergylta GN=BCL2L1 (length=221 residues).
MSYSNRELVEFFISYKLSQRNYPTYVLRSEDAGERTEGDMENSAASNGFLVNSRNRAGQSVMSSSPHTDIEAVKAALLDS
ADEFELLFTQAFSDLSSQLDITPNTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVECVQKDMGELVSRIAGWMTTY
LDEHISAWIESQGGWDCFVEIFGRGAVGEVRRSRETLTRWLLVGMALLMGVVVGVYIAKKH
>gnl|bcl2dbpro|A0A3Q3G2E1_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Labrus bergylta GN=BCL2L1 (length=234 residues).
MSQNRELVVFYITYKFSQRNYPLNHMELLEPPNRTDGAGAGSGEEQQVATHANGTFNGTSPGTPPASPHRQQQQRLPATT
NLDAVKEALRDSANEFELRYASAFSDLHNQLHITPATTHQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSP
LVGRIIEWMTVYLDNRIQPWIESQGGWERFSEIFGQDAAGEIRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q3G2E1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Labrus bergylta GN=BCL2L1 (length=234 residues).
MSQNRELVVFYITYKFSQRNYPLNHMELLEPPNRTDGAGAGSGEEQQVATHANGTFNGTSPGTPPASPHRQQQQRLPATT
NLDAVKEALRDSANEFELRYASAFSDLHNQLHITPATTHQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSP
LVGRIIEWMTVYLDNRIQPWIESQGGWERFSEIFGQDAAGEIRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q3G2E1_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Labrus bergylta GN=BCL2L1 (length=234 residues).
MSQNRELVVFYITYKFSQRNYPLNHMELLEPPNRTDGAGAGSGEEQQVATHANGTFNGTSPGTPPASPHRQQQQRLPATT
NLDAVKEALRDSANEFELRYASAFSDLHNQLHITPATTHQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSP
LVGRIIEWMTVYLDNRIQPWIESQGGWERFSEIFGQDAAGEIRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|H3ANS8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Latimeria chalumnae GN=BCL2L1 (length=239 residues).
KMSFNRLLVVDHISQKLMQRGYQWREVGEQDHGGGGDRAREAQTPEEGAIPGMDPPNGSHPHAGLNGAVNGLPAGSSSRL
EAQAVSGPEAVKRTLREAGEEFELRYSRAFSDLSSQLHITPGTAYQSFEQVVNELFRDGVNWGRVVAFFAFGGALCVESM
DKEMSSLVERIAEWMTTYLDDNLNPWIQEQGGWATIIHIDGVDAMQRSNTRSEKLGFVGFFFSFLLRGVERNLKLFLRK
>gnl|bcl2dbpro|E2IV76_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Lemur catta GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFIDAEENRTEAPEGTESEMETPSAINGNPSWHLADSPPANGATGHSSSLDAREV
IPMAAVKQALKEAGDEFELRYRRAFSDLTSQLHITLGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|W5MG74_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Lepisosteus oculatus GN=BCL2L1 (length=222 residues).
KMSYSNRDLVVYYINYKLSQKNYSWDQFSLEGRTGGAEAVGSGSPNAEERTNGAANGGGGPVSRQPPQGIEAVQGALRDS
ANEFELRYGRAFSDLSSQLHITPATAYQSFEHVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSNLVSRIAEWMTVY
LDNNIQPWIQSQGGWDRFAEIFGKDAAAEYRRSQESFKKWLLAGMTLVTGLVVGSYIAKKRL
>gnl|bcl2dbpro|Q4U2V6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Lonchura striata GN=BCL2L1 (length=230 residues).
MSSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAGEEDEMDGVLNGSPSWHAATSHIVNGATVHQSSLEVHEIRRA
ADVRQALREAGDEFELRYRRAFSDLTSQLHITPSTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVVKEMRVLV
KRIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEMRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|G3SPN0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Loxodonta africana GN=BCL2L1 (length=234 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTGASEGTESEMEIPSAINGNPSRHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWVRTTPLLCFSTSVKEDIAYVFIQVKTYASGKLVQCFLTLTQWFTTQ
>gnl|bcl2dbpro|A0A2K5VPG2_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L1 (length=145 residues).
MWKRTGLRPQKGLNRRWRPPVPSMATHPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAA
WMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K5VPG2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|I7GKS6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L1 (length=148 residues).
MWKRTGLRPQKGLNRRWRPPVPSMATHPGTPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSR
IAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|Q2PFS6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L1 (length=189 residues).
METPSAINGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFE
QVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESR
KGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|F6UKR4_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L1 (length=145 residues).
MWKRTGLRPQKGLNRRWRPPVPSMATHPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAA
WMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|F6UKR4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K5YR37_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Mandrillus leucophaeus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K5YR37_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Mandrillus leucophaeus GN=BCL2L1 (length=170 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGV
VLLGSLFSRK
>gnl|bcl2dbpro|A0A2K5YR37_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Mandrillus leucophaeus GN=BCL2L1 (length=145 residues).
MWKRTGLRPQKGLNRRWRPPVPSMATHPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAA
WMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A3Q3MX20_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Mastacembelus armatus GN=BCL2L1 (length=232 residues).
MSQNRELVVFYIKYKLSQRNYPLIYIELNEQQNRTDGGEAESGEEQRIATHANGTFNGTSPGTPPASPLRQEHLQSTASL
DAVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQSFESVMDEVFRDGVNWGRIIGLFAFGGALCVECVEKEMSPLV
GRIVEWMTLYLDNHIEPWIQSQGGWEHFAEIFGQDAAAESRRSQENFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q3NFM4_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Mastacembelus armatus GN=BCL2L1 (length=221 residues).
MSYSNRELVEFFISYKLSQKNYPTSLLRPEDAGGRTEGDMTGAAATNGLLVNSRYVSGRPGMSSSPHGGVEAVKAALRDS
AEEFELLFTQAFSDLSSQLDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVECIEKNMSALVSRIADWMTMY
LDEHISPWIESQGGWDCFAEIFGRDAAAEARRSQETLRRWLLVGVALLTGVLIGVLIAKKQ
>gnl|bcl2dbpro|A0A3Q3NFM4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Mastacembelus armatus GN=BCL2L1 (length=221 residues).
MSYSNRELVEFFISYKLSQKNYPTSLLRPEDAGGRTEGDMTGAAATNGLLVNSRYVSGRPGMSSSPHGGVEAVKAALRDS
AEEFELLFTQAFSDLSSQLDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVECIEKNMSALVSRIADWMTMY
LDEHISPWIESQGGWDCFAEIFGRDAAAEARRSQETLRRWLLVGVALLTGVLIGVLIAKKQ
>gnl|bcl2dbpro|A0A3P9D632_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Maylandia zebra GN=BCL2L1 (length=233 residues).
MSQNRELVLFYIRYKLSQRNYPLNHIVLNEPSNRTDGGAAGLDEEQRIDTHANGTFNGTSPGTPPASPQRRQQQPPSTTD
LDAVKEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPL
VGRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVAGALIAQKRL
>gnl|bcl2dbpro|A0A3P9D632_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Maylandia zebra GN=BCL2L1 (length=233 residues).
MSQNRELVLFYIRYKLSQRNYPLNHIVLNEPSNRTDGGAAGLDEEQRIDTHANGTFNGTSPGTPPASPQRRQQQPPSTTD
LDAVKEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPL
VGRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVAGALIAQKRL
>gnl|bcl2dbpro|G1N5N5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Meleagris gallopavo GN=BCL2L1 (length=229 residues).
MSSSNRELVIDFVSYKLSQKGHCWSELEEEDENRTDTAAEAEMDSVLNGSPSWHPPAGHVVNGAAVHRSSLEVHEIVRAS
DVRQTLRDAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFHDGVNWGRIVAFFSFGGALCVESVDKEMRVLVG
RIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNNAAAELRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A3Q3WIW8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Mola mola GN=BCL2L1 (length=230 residues).
MSVNRELVAYYINYKLSHRGCPLNHMGLIEPPNRTEGGQAVSDEEQRVATHANGTFNGTSPGTPPRSPLRLQPSTTSLDA
VKDALRDSANEFELRYARAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGR
IIEWMTVYLDNQIQPWIESQGGWQRFAEIFGQDAAAESRRSQESFKKWLLAGMTLVTGVVVGSLIVQKRL
>gnl|bcl2dbpro|A0A3Q3X5M5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Mola mola GN=BCL2L1 (length=218 residues).
MSHSNRELVEFFISYKLTQKNYPTSLLRPEDTGGRTEGDKASSAARNGLLVNSSSRGGLSPSTGADMEAVKSALRDSANE
FEQLFTQAFSDLSSQLDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVECAEKDTGELVCRIADWMTTYLDE
HINPWIQSQGGWGCFAEVFGHNAAAEARRSQETLNRWLLVGVALLMGVMVGVFIAKKQ
>gnl|bcl2dbpro|F6WA14_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Monodelphis domestica GN=BCL2L1 (length=227 residues).
MSHSNRELVIDFLSYKLSQKGYNWSQFEDENRTEVLEGAEIPSTVNGSPSWHPADSRAVSGATGHSSSLDAHETIPVAAV
KQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMEVLVGRI
TSWMATYLDDHLDPWIQENGGWDTFVELYGNDAAAESRKGQERFNRWLLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A3Q3IVF5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Monopterus albus GN=BCL2L1 (length=223 residues).
MSQNKELVVFYITYKLSQKNYPLSHLGLNESPNRTDGEEATHANGTFNGTSPGTPPASPLRQQQLPSTANLDAVKEALRD
SANEFELRYARAFSDLHHQLHITPATAYQSFESVMDEVFRDGVNWGRIIGLFAFGGALCVECVEKEMSPLVGRIVEWMTV
YLDNHIQPWIQGQGGWERFAELFGQDAAAENRRSQESFKKWLLAGMTLVTGVVVGSLIIQKRL
>gnl|bcl2dbpro|A0A3Q3J5K3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Monopterus albus GN=BCL2L1 (length=202 residues).
MSYSHRELVEFYISYKLSQRNYSTSLLRPENAGGRTEGDRTNPATTNGLGIEAVKAALRDSADEFELRFTQAFSDLSSQL
VITPDTAYNSFKSVMDEVFKDGVNWGRIVGLFAFGGALCVECVEKNMSELVSRIADWMTMYLDEHISPWIQNQGGWDCFA
EIFGRDNAAEVRRSQETLRRWLLVGVVLLTGVLVGVLVAKKL
>gnl|bcl2dbpro|O35843_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Mus musculus GN=BCL2L1 (length=235 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWGVSGGTPLRSVFRRLVQVPGVAEHVCDPSLWEVETEGSEVQGPPQLL
>gnl|bcl2dbpro|Q64373_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Mus musculus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|Q64373_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Mus musculus GN=BCL2L1 (length=209 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWVRTTPLVCPPLACVSLLCEHP
>gnl|bcl2dbpro|Q64373_BCL2L1-04 BCL2-like 1 protein OS=[Eukaryota] Mus musculus GN=BCL2L1 (length=209 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWVRTTPLVCPPLACVSLLCEHP
>gnl|bcl2dbpro|Q64373_BCL2L1-09 BCL2-like 1 protein OS=[Eukaryota] Mus musculus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|M3Z2H9_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Mustela putorius furo GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDAEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
ALVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|G1P9D2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Myotis lucifugus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEVETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|R4JQR8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Mytilus galloprovincialis GN=BCL2L1 (length=185 residues).
MNQFSSRYLVADFINDRLRKHGMRWDNCPTLDLPPSQIQLKLRSLGDEFQERFQTQFDDMVNQLHITEATAYPTFQRVVQ
ELFIDGNINWGRIVALFGFGGSLSVKCVQRGMPQLVDSIVDWVSTYLCNSLEQWITDNGGWQGFVEAYNQGQNHNDSPWD
VKGLVKYGAIGVIGAMALSAFLHRT
>gnl|bcl2dbpro|A0A3Q4N4B5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Neolamprologus brichardi GN=BCL2L1 (length=233 residues).
MSQNRELVLFYIRYKLSQRNYPLNHIVLNEPSNRTDGGAAGLDEEQRIDTHANGTFNGTSPGTPPASPQRRQQQPPSTTD
LDAVKEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPL
VGRIVEWMTVYLDNHIQPWIQSQGGWEHFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVAGALIAQKRL
>gnl|bcl2dbpro|G1RER8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2L1 (length=217 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTG
>gnl|bcl2dbpro|C3VIT1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Odontesthes bonariensis GN=BCL2L1 (length=235 residues).
MSQNRELVVFYIKYKLSQRNYPLNHIVLNEPPNRTGAGDGGLGEEQSTETHANGTFTGTSPGTPPVSPLRQQPLPSTTTT
TRLDAVKEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEREMS
PLVGRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVVGSLFAQKRL
>gnl|bcl2dbpro|A0A286MU87_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oncorhynchus mykiss GN=BCL2L1 (length=216 residues).
MSYSNRELVVFFISYRLSQRNYSCCQLGLEGASGRTDGDEAIANGSVGNYRNSRSNLAKPSSPQGGMEPVKAALRDSVDE
FELRYTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSPLVARIADWMTTYLDN
HIQPWIQSQGGWAEIFGRDAAADVRRSQESIIKWLLVGVILLSGVLVGTLIMKKRQ
>gnl|bcl2dbpro|I3IZK7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oreochromis niloticus GN=BCL2L1 (length=234 residues).
YKMSQNRELVLFYIRYKLSQRNYPLNHIVLNEPLNRTDGGAAGLDEEQRIDTHANGTFNGTSPGTPPASPQRQQQPPSTT
DLDAVKEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSP
LVGRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVAGALIAQKRL
>gnl|bcl2dbpro|Q9MYW4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryctolagus cuniculus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTGPEMETPSAINGNPAWHPADSPAVNGATGHSSSLDAREV
IPMTAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEME
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A3B3IB64_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L1 (length=230 residues).
MSRNRELVVFYVKYKLSQRNYPLNHIVLNESPNRTAAGEVGEEQSTETHANGTFNGTTPGTPPLSPLREQQLPSTTNMDA
VKEALRDTANEFELRYALAFNNLHSQLHITPATAYQSFENVMNELFRDNINWGRIVGLFAFGGALCVECVEKEMSPLVDR
IVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQEAAAESRRSQESFKKWLLVGMTVATGVLVGSFLAQKRL
>gnl|bcl2dbpro|A0A3B3ICL7_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L1 (length=214 residues).
MTKWKKSWHLTYKMSCRDYPVSLLKPTDDGGETEEDHSDARNRRLVSSEDGRLRRSCPCCASMDAIKSTLKDSADEFERR
FHQGFSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVECVERNMGELVSRIAEWMTQYLDEQISP
WIHSHGGWDCFARLYGQNGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKKR
>gnl|bcl2dbpro|A0A3B3ICL7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L1 (length=217 residues).
MSHCNRELVRFYLAYKMSCRDYPVSLLKPTDDGGETEEDHSDARNRRLVSSEDGRLRRSCPCCASMDAIKSTLKDSADEF
ERRFHQGFSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVECVERNMGELVSRIAEWMTQYLDEQ
ISPWIHSHGGWDCFARLYGQNGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKKR
>gnl|bcl2dbpro|A0A3P9JYH1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L1 (length=230 residues).
MSRNRELVVFYVKYKLSQRNYPLNHIVLNESPNRTAAGEVGEEQSTETHANGTFNGTTPGTPPLSPLREQQLPSTTNMDA
VKEALRDTANEFELRYALAFNNLHSQLHITPATAYQSFENVMNELFRDNINWGRIVGLFAFGGALCVECVEKEMSPLVDR
IVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQEAAAESRRSQESFKKWLLVGMTVATGVLVGSFLAQKRL
>gnl|bcl2dbpro|A0A3B3DHA1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryzias melastigma GN=BCL2L1 (length=230 residues).
MSRNRELVVFYVKYKLSQRNYPLNHIVLNESPNRTAAGEVGEEQSTETHANGTFNGTSPGTPPLSPLRQQQLPSTTNMDA
VKEALRDTANEFELRYALAFNNLHSQLHITPATAYQSFENVMNELFRDNINWGRIVGLFAFGGALCVECVEKEMSPLVDR
IVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQEAAAESRRSQESFKKWLLVGMTVATGVLVGSFIAQKRL
>gnl|bcl2dbpro|A0A3B3E2W4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryzias melastigma GN=BCL2L1 (length=217 residues).
MSHCNRELVQFYLGYKMSSRDYPVSLLKPTDDGGQTAEDRSATCNGTLVNSEDGQLKKSCPCCASMDAIKSTLKDSANEF
ERRFSQGFSDLSLQFHITPDTAYQNFKSVLDELFKDGINWGRVVGLFVFGGVLCVECVERNMSELVSRIAEWMTMYLDEQ
ISPWIHSQGGWDCFAQLYGQDGAAEARRFQETLKKWTLVAVALLTGLLLGLLIAKKR
>gnl|bcl2dbpro|C1BLI0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Osmerus mordax GN=BCL2L1 (length=222 residues).
MSYSNRELVVFFISYKLSQRNYPISQLGLEDASERTNVDKTNVSPVNGSVENDRNCIGSLGISSSPQGGIEAVKAALRDS
ADEFELRYTRAFNDPSSQLHITPATAYHSFESVMNEVFRDGVNWGRVVGLFAFGGALCAECVEKDMSHLVARIADWMTTY
LDNHIQPWIQRQGGWDRFADIFGRDAAAEVRRSQENLRRWLLVGAILLAGVLVGSLIAKKHH
>gnl|bcl2dbpro|H0X6V2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Otolemur garnettii GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFISYKLSQKGYSWSQFSDVEENRTEAPEGNESELETPSAINGNPSWHLADSPTVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWWRCQAFPELLSPKSNSIYFKVCMCGNFCSLAAAGRCLTIGVMGYS
>gnl|bcl2dbpro|Q9MZS7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Ovis aries GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNPSWHLADSPAVNGATGHSRSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|W5PSA5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Ovis aries GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKFFQKGYSWSQFSDMEENRTETLEGTESDMETPSAISGNPSWHLADSPVVNGATGHSRSLDTGKM
IPMAVVKQALREASNECELRYQQTFSDLTSQLHITPGKAYQSFEQVINELFQDGVNWGRNVAFFSFGGALCMKSIVKEMQ
VLVSQVTTWMATYLNDHLEPWIQENGDWDIFVELYENNTATESQKGQEHLNRWSLTDMTVAGMALLGLLFNCK
>gnl|bcl2dbpro|A0A3B3QRZ2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Paramormyrops kingsleyae GN=BCL2L1 (length=237 residues).
MSYSNRELVMDFITYKLSQRNYNGHFGLPEDRGRTEGSGQADGREGVMVTATHVNGSVIAGGTSSQVSPVPEQPLHSPSP
SPQGLEAVKEALRDSANEFELRYSRAFSDLSSQLHITPVTAYQSFESVMNEVFRDGINWGRIVGLFAFGGALCVECVEKE
MGHLVDRIADWMTVYLDSNIQPWIQRQGGWDRFAEIFGKDAAAESRRSQENFKKWLLAGMTLITGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3B3TFR4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Paramormyrops kingsleyae GN=BCL2L1 (length=226 residues).
MSYSNRELVEYFVSYKLAQKNYSIAHIIQDEADEQTGGGEGEAAGAVAHANGSVSSGNSVGQGAPLEGATPQGLEAVKEA
LRLSANEFEFRYQRAFSDLSSQLHITPATAYQSFESVMNEVFRDGVNWGRVVGLFAFGGALCVECVEKEMSPLVGHIVDW
MTVYLDNHIQPWIQTQGGWDRFAEIFGNDAAAEGRRSRERFQQWLPAAMALVAGALVGFLIAKKRQ
>gnl|bcl2dbpro|K7F655_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Pelodiscus sinensis GN=BCL2L1 (length=229 residues).
MSNTNRELVIDFLSYKLSQRGHSWSWFEGEDEIRTEAAEEAEMASVPNGSPSWHPGASHVVNGAAGHSNSLEAHERVPAA
EVRQALREAGDEFELRYRRAFSDLTSQLHITLGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVG
RIASWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAKSRKGQEQFNRGLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A3B3ZN55_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Periophthalmus magnuspinnatus GN=BCL2L1 (length=214 residues).
MSLNRELVEFYIQYKLSQRDCPLGLEDGTEIDTERDRDLLGLGDRSVDRNSTPSLRLRLDSASDSAPALRDSANEFELRF
SRAFSDLHRQLHITPATAYQSFESVMDEVFRDGVNWGRVVGLFAFGGALAVECVDKEMSTLVARIVTWMTVYLDEHIQDW
IDSQGGWARFAEIYGQDAAAQSRHSEERFKKWLFAGMTLVTGVVVGSLLAQRRL
>gnl|bcl2dbpro|A0A3B3ZN55_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Periophthalmus magnuspinnatus GN=BCL2L1 (length=235 residues).
MSLNRELVEFYIQYKLSQRDCPLQHLGLGDRSTQSDTEHLGLGDRGVDRARLQRETEVDSTELRLDSASDSAPVHSPAPL
LDLDAVKEALRDSANEFELRFSRAFSDLHRQLHITPATAYQSFESVMDEVFRDGVNWGRVVGLFAFGGALAVECVDKEMS
TLVARIVTWMTVYLDEHIQDWIDSQGGWARFAEIYGQDAAAQSRHSEERFKKWLFAGMTLVTGVVVGSLLAQRRL
>gnl|bcl2dbpro|A0A3B4BFZ8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Periophthalmus magnuspinnatus GN=BCL2L1 (length=218 residues).
MSPSNRELVEFFISYKLSQKNYPSSLLMSDPARVQCEGNKAANVPNGMLTNRNGNRQTLASLPPDDHLDAIKTALTDSAD
EFEELFTQAFSNLSSQLDITPDTAYNSFKSVMDEVFKDGVNWGRIVGLFVFGGVLSVECVEKDMSILVPRIANWMTIYLD
ENIATWIQNQGGWASFAQIFGQNAAGEARRSRETLKKWLLVGVGLLAGVLVAMLIAKK
>gnl|bcl2dbpro|A0A346RRN1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Perna viridis GN=BCL2L1 (length=185 residues).
MNQYSSRYLVVDFVNDRLRKNGLQWENCPSLEVPPSQVQLTLRTIGDEFQERFRTQFDDMVDQLHITEATAYPTFQRVVQ
ELFIDGNINWGRVVALFGFGGALSVECVQNGMPQLVDSIVDWVSVYLCDNLEPWITSNGGWQGFVEYYNQAQNHNDNQWN
LGEFVRYGAIGVVGALALGALLQRV
>gnl|bcl2dbpro|A0A087X9B7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Poecilia formosa GN=BCL2L1 (length=231 residues).
MSRNRELVLFYIKFKLSQRNYPIQHILPNEPPDSTAAGDAAGDAGMDDEQTLETHANGTFNGTSPGSPRRQQAASAATMD
AVKVTLRDTAREFELRYSRAFNDLHSTLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSHLVA
RIVEWMTVYLDERIEPWVESQGGWDRFAEIFGGNAAAESRRSQESFKNWLLLGMSVVTAFIAGSIFAQKRL
>gnl|bcl2dbpro|A0A087YBW4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Poecilia formosa GN=BCL2L1 (length=219 residues).
MSYSNRELVEFYISYKLSQRNYSSSLLRSEADGARTNWDGDSRGPSNGPLVNSWAGSPGKSRDPPTGVKVVKLVLKDAAE
EFERLYTQSFKHLSLQLDITPDTAYQSFKTVLDELFKGEVNWGRVVAMFTFGGILCVDCVQKNMSELVSRIAEWMTTYLD
EQLNPWIQSQGGWDRFANLYGQDAAAEGRRFRETLNKWLLVGVALLTGALLVMFVAKKR
>gnl|bcl2dbpro|A0A3B3TUS7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Poecilia latipinna GN=BCL2L1 (length=231 residues).
MSRNRELVLFYIKFKLSQRNYPIQHILPNEPPDSTAAGDAAGDAGMDDEQTLETHANGTFNGTSPGSPRRQQAASAATMD
AVKVTLRDTAREFELRYSRAFNDLHSTLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSHLVA
RIVEWMTVYLDERIEPWVESQGGWDRFAEIFGGNAAAESRRSQESFKNWLLLGMSVVTAFIAGSIFAQKRL
>gnl|bcl2dbpro|A0A3B3VWI7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Poecilia latipinna GN=BCL2L1 (length=219 residues).
MSYSNRELVEFYISYKLSQRNYSSSLLRSEADGARTNWDGDSRGPSNGPLVNSWAGSPGKSRDPPTGVKVVKLVLKDAAE
EFERLYTQSFKHLSLQLDITPDTAYQSFKTVLDELFKGEVNWGRVVAMFTFGGILCVDCVQKNMSELVSRIAEWMTTYLD
EQLNPWIQSQGGWDRFANLYGQDAAAEGRRFRETLNKWLLVGVALLTGALLVMFVAKKR
>gnl|bcl2dbpro|A0A3B3WI27_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Poecilia mexicana GN=BCL2L1 (length=231 residues).
MSRNRELVLFYIKFKLSQRNYPIQHILPNEPPDSTAAGDAAGDAGMDDEQTLETHANGTFNGTSPGSPRRQQAASAATMD
AVKVTLRDTAREFELRYSRAFNDLHSTLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSHLVA
RIVEWMTVYLDERIEPWVESQGGWDRFAEIFGGNAAAESRRSQESFKNWLLLGMSVVTAFIAGSIFAQKRL
>gnl|bcl2dbpro|A0A3B3XN57_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Poecilia mexicana GN=BCL2L1 (length=219 residues).
MSYSNRELVEFYISYKLSQRNYSSSLLRSEADGARTNWDGDSRGPSNGPLVNSWAGSPGKSQDPPTGVEVVKSVLKDAAE
EFERLYTQSFKHLSLQLDITPDTAYQSFKTVLDELFKGEVNWGRVVAMFTFGGILCVDCVQKNMSELVSRIAEWMTTYLD
EQLNPWIQSQGGWDRFANLYGQDAAAEGRRFRETLNKWLLVGVALLTGALLVMFVAKKR
>gnl|bcl2dbpro|A0A3P9N9Y4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Poecilia reticulata GN=BCL2L1 (length=231 residues).
MSRNRELVLFYIKFKLSQRNYPIQHILPNEPPDSTAARDAAGDGGMDDEQTLETHANGTFNGTSPGSPRRQQAASASTMD
AVKVTLRDTAREFELRYSRAFNDLHSTLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSHLVA
RIVEWMTVYLDERIEPWVESQGGWERFAEIFGGNAAAESRRSQESFKNWLLLGMSVVTAFIAGSIFAQKRL
>gnl|bcl2dbpro|A0A3P9QFB3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Poecilia reticulata GN=BCL2L1 (length=217 residues).
MSYSNRELVEFYISYKLSQRNYSSSLLRSEADGARTNWDGDSRGPSNGPLVNSRAGSRGKSQGPPVEVVKSVLKDAAEEF
ERLYTQSFKHLSLQLDITPDTAYHSFKTVLDELFKGEVNWGRVVAMFTFGGILCVDCVQKNMSELVSRIAEWMTTYLDEQ
LNPWIQSQGGWDHFANLYGQDAAAEGRRFRETLNKWLLVGVALLTGALLVMFIAKKR
>gnl|bcl2dbpro|A0A2J8VIH3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Pongo abelii GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K6G3C5_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Propithecus coquereli GN=BCL2L1 (length=145 residues).
MQKRTGLRPQKRLNRRWRPPVPLMATHPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAT
WMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K6G3C5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Propithecus coquereli GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFIDAEENRTEAPEATESEMETPSAINGNPSWHLADSPPANGATGHSSSLDAREV
IPMAAVKQALKEAGDEFELRYRRAFSDLTSQLHITLGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A3B4FNX1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Pundamilia nyererei GN=BCL2L1 (length=233 residues).
MSQNRELVLFYIRYKLSQRNYPLNHIVLNEPSNRTDGGAAGLDEEQRIDTHANGTFNGTSPGTPPASPQRRQQQPPSTTD
LDAVKEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPL
VGRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVAGALIAQKRL
>gnl|bcl2dbpro|A0A3B4DTL9_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Pygocentrus nattereri GN=BCL2L1 (length=238 residues).
MSYYNRELVVYFIKYKLSQRNYPYNHIGLMEDTNRTEGGQAAEENAEGAAVTPTAVVNGSVNGTSHGPAGSPTSSPQRRS
NGAGGLDAVKEALRDSANEFELRYSRAFSDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEK
EMSPLVGRIAEWMTVYLDNHIQPWIQEQGGWERFAEIFGKDAAAESRRSQENFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|P53563_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Rattus norvegicus GN=BCL2L1 (length=284 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWVRTTPLVCPPLVCLSSVEIPNCPFWSPGMVVEDIDYSGDIPGFTLIPGVNFG
NIDDPVFKEPVFFILATLVAPQFHSFVPISRQRKTACVFTWLKT
>gnl|bcl2dbpro|P53563_BCL2L1-04 BCL2-like 1 protein OS=[Eukaryota] Rattus norvegicus GN=BCL2L1 (length=232 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWVRTTPLVCPPLVCLSSVEIPNCPFWSPGMVVEDIDYSGDIPGSL
>gnl|bcl2dbpro|P53563_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Rattus norvegicus GN=BCL2L1 (length=284 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWVRTTPLVCPPLVCLSSVEIPNCPFWSPGMVVEDIDYSGDIPGFTLIPGVNFG
NIDDPVFKEPVFFILATLVAPQFHSFVPISRQRKTACVFTWLKT
>gnl|bcl2dbpro|P53563_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Rattus norvegicus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K6LPM4_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2L1 (length=145 residues).
MWKRTGLRPQKGLNRRWRPPVPSMATHPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAA
WMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K6LPM4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K6QFA2_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K6QFA2_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L1 (length=145 residues).
MWKRTGLRPQKGLNRRWRPPVPSMATHPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAA
WMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K6QFA2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K6UWY8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTDSEMETPSAINGNPAWHLADSPAVNGATGHSSSLDAREV
IPMAAIKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K6UWY8_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L1 (length=146 residues).
MWKRTGLRPQKGLIRRWRPPVPSMLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIA
AWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|E2IV77_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Saimiri boliviensis GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTDSEMETPSAINGNPAWHLADSPAVNGATGHSSSLDAREV
IPMAAIKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|B5XAY3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Salmo salar GN=BCL2L1 (length=228 residues).
MMTYNNRELVVYYITYKLSQRDYPFNHMELTEAQNRTEVGQVEGGAAVLTYVNGTSPGTPPPRQSPPSSPRRTAGLDAVK
EALRDSANEFELRYARAFSDLSSQLHITPSTAYQSFENVMDEVFRDGVNWGRVVGLFSFGGALCVECVDKEMNPLVGRIT
DWMTVYLDNHIQPWIQSQGGWDRFAEIFGMDAAAESRKSQESFKKWLLAGMTLVTGVVVGSLFAQKRL
>gnl|bcl2dbpro|C0HAD8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Salmo salar GN=BCL2L1 (length=216 residues).
MSYSNRELVVFFISYRLSQRNYSCCQLGLEGASGRTEGDDAIANGSVGNSRSNLAKPSSPQGGMEPVKAALRDSVDEFEL
RYTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSPLVARIADWMTTYLDNHIQ
PWIQSQGGWDRFAEIFGRDAAADVRRSQESIIKWLLVGVILLSGVLVGTLIMKKRQ
>gnl|bcl2dbpro|G3WKX6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL2L1 (length=227 residues).
MSHSNRELVVDFLSYKLSQKGYNWSQFEDENRTEASEGTEIPSTVNGSPSWHPADSRAVSGATGHSSSLDAHETIPVAAV
KQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMEVLVARI
TSWMATYLDEHLDPWIQENGGWDTFVELYGNDAAAESRKGQERFNRWLLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2U9BIG9_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Scophthalmus maximus GN=BCL2L1 (length=222 residues).
MSDSNRELVEFFIGYKLSQRNYPTSLLRPEDAGGRTEGDKANSAASNGLLVDGGNRCGQLGTDPLPPDGGVGAVKEALRD
SAHEFEQLFNQAFSDLSLQLDITPDTAYQSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVECVEKNRGELVARIADWMTM
YLDEHISPWIQSQGGWGCFAEIFGQGAGAEARRYRESVRRWLLVGVGMLTGVLIAMFIAKKQ
>gnl|bcl2dbpro|A0A2U9BY16_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Scophthalmus maximus GN=BCL2L1 (length=232 residues).
MSQNKELVVFYIQYKLSQRKYPLNHMGLNEPPNRTDRGEAGLGEEQQTAPHANGTLNGVNPGTPPESPLRLQRLPSSPSL
DAVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQSFESVMNEVFRDGVNWGRIIGLFAFGGALSVECVEKEMSSLV
GRIVEWMTVYLDNNIQPWIQSQGGWEHFAEIFGQDAAAGSRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3B4V3T1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Seriola dumerili GN=BCL2L1 (length=232 residues).
MSQNRELVVFYIKHKLSQRNYPLTHMELNESPNRTDGGEAGLVEEQRIATHANGTFNGTSPGTRAESPQRQQRLPSTTSL
DAVKEALRDSANEFELRYSRAFSDLHNQLHITPATAYQSFANVMDEVFRDGFNWGRIIGLFVFGGALCVECVEKEMSPLV
GRIVEWMTVYLDNRIQPWIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3B4V9K8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Seriola dumerili GN=BCL2L1 (length=221 residues).
MSYSNRELVEFFISYKLSQSNCPTSLLRPEDAGGRTEGDKANSAASNGLLVNSSDRCGQPGTSSPPHGGIEAVKSALKDS
ADEFELLFNQAFSDLSTQLDITPDTAYHSFKSVMDELFKDGVNWGRIVGLFAFGGVLCVECIQKNMSELVSRITDWMTMY
LDEHISPWIQSQGGWDCFAEMFGQDAAAEARRSREAVMKWLLVGVAMLAGVLMGVLIVKKH
>gnl|bcl2dbpro|A0A3B4XS24_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Seriola lalandi dorsalis GN=BCL2L1 (length=221 residues).
MSYSNRELVEFFISYKLSQSNCPTSLLRPEDAGGRTEGDKASSAASNGLLVNSSDRCGQPGTSSPPHGGIEAVKSALKDS
ADEFELLFNQAFSDLSTQLDITPDTAYHSFKSVMDELFKDGVNWGRIVGLFAFGGVLCVECIQKNMSELVSRIADWMTMY
LDEHISPWIQSQGGWDCFAEMFGQDAAAEARRSREAVRRWLLVGVAMLAGVLMGVLIVKKH
>gnl|bcl2dbpro|A0A3B4XU17_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Seriola lalandi dorsalis GN=BCL2L1 (length=232 residues).
MSQNRELVVFYIKYKLSQRNYPLTHMELNESPNRTDGGEAGLVEEQRIATHANGTFNGTSPGTRPESPQRQQRLPSTTSL
DAVKEALRDSANEFELRYSRAFSDLHNQLHITPATAYQSFANVMDEVFRDGFNWGRIIGLFVFGGALCVECVEKEMSPLV
GRIVEWMTVYLDNRIQPWIQSQGGWERFAEIFGQDAAADSRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A0B4KJI5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Sparus aurata GN=BCL2L1 (length=215 residues).
MSYSNRELVESFLSYKLSQRNYPTALLRPDDAGGRTEADKANSAATNGLLANSSNGGGQPGADIEAVKAALRDSSEEFEL
LFTQAFSDLSTQLDITPDTAYHSFKSVMDEVFKDGVNWGRVVGLFAFGGVLCVECVEKDTSELVSRIADWMTMYLDEHIN
PWIESQGGWDSFAEVFGRDAAAEARRSRETLSRWLLVGVALLMGVVLGVLIAKKQ
>gnl|bcl2dbpro|A0A3B4Z3X2_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Stegastes partitus GN=BCL2L1 (length=229 residues).
MSQNRELVVYYIKYKLSQRNYPLNHMVLNEAPNRTDGGEARLAEEQRTETHANGTFNGTSPGTPPPSPRRLASTATMDAV
KEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRI
VEWMTVYLDNHIQDWIQSQGGWDRFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3B4Z3X2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Stegastes partitus GN=BCL2L1 (length=229 residues).
MSQNRELVVYYIKYKLSQRNYPLNHMVLNEAPNRTDGGEARLAEEQRTETHANGTFNGTSPGTPPPSPRRLASTATMDAV
KEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRI
VEWMTVYLDNHIQDWIQSQGGWDRFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3B5B4X7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Stegastes partitus GN=BCL2L1 (length=211 residues).
MEIMSYSNRELVEFFISYKLSQRNYPTSLLRPEDAAGRTEGDKTNSAASNGLLVNSRGGIEAVKAALKDSADEFELLFTQ
AFSDLSSQLDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFCFGGVLCVECVDKNMNELVPRIADWMTMYLDEHISLWIQ
SQGGWECFAEIFGQDAAAEARRSRDSLKRWLLVGGALLTGVLAGVLIAKKQ
>gnl|bcl2dbpro|O77737_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Sus scrofa GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEAETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVLNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTLAGVVLLGSLFSRK
>gnl|bcl2dbpro|H0Z8G3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Taeniopygia guttata GN=BCL2L1 (length=228 residues).
MYSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAGEEDEMDGVLNGSPSWHAATSHIVNGATVHQNSLEVHEIRRA
ADVRQALREAGDEFELRYRRAFSDLTSQLHITPSTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVVKEMRVLV
KRIVSWMTTYLTDHLDPWIQENGGWERFVDSMNDAAAEMRKGQEFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A0F7L1T6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Takifugu obscurus GN=BCL2L1 (length=218 residues).
MSYNNRELVEHFLRYKLSQRNYPSSLLRPEDTDGRTEGEKRSPAASNGLLVRSRNRGGASPSAGAGIEAVNAALRDSAEE
FEKLFAQAFSDLSSQLDITPDTAYQSFKNVMDEVFKDGDNWGRVVGLFAFGGVLCVECVERDASQLVCRIADWMTIYLDE
HINPWIQSQGGWDCFAKIFGDDAAAEGRRARENLSRWMLGGLALLMGVLVGAFIVKKH
>gnl|bcl2dbpro|A0A3B5K6B9_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Takifugu rubripes GN=BCL2L1 (length=218 residues).
MSQNRELVIFYIKYKLSQRNYPFNHNGLILEPPSRTDGQFVTTQFNGTFNGASPGTPPATSLATSLDTVKEALRDTGNEF
ELRYTCAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRIIEWMTVYLDNH
IQPWIQSQGGWVRFAELFGQDAAAESRRSQERFRNGLLVGMSLAAGIAIGSFIVRKLL
>gnl|bcl2dbpro|A0A3B5K6B9_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Takifugu rubripes GN=BCL2L1 (length=218 residues).
MSQNRELVIFYIKYKLSQRNYPFNHNGLILEPPSRTDGQFVTTQFNGTFNGASPGTPPATSLATSLDTVKEALRDTGNEF
ELRYTCAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRIIEWMTVYLDNH
IQPWIQSQGGWVRFAELFGQDAAAESRRSQERFRNGLLVGMSLAAGIAIGSFIVRKLL
>gnl|bcl2dbpro|H2U5I3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Takifugu rubripes GN=BCL2L1 (length=218 residues).
MSYNNRELVEHFLRYKLSQRNYPTSLLRPEDTDGRTEGEKRSPGASNGLLVRSRNRGGASPSAGAGIEAVNAALRDSAEE
FEKLFAQAFSDLSSQLDITPDTAYQSFKNVMDEVFKDGVNWGRVVGLFAFGGVLCVECVEKDASQLVCRIADWMTIYLDE
HINPWIQSQGGWDCFAKIFGDDAAAEGRRARENLSRWMLGGLALLMGVLVGAFIVKKH
>gnl|bcl2dbpro|H2U5I3_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Takifugu rubripes GN=BCL2L1 (length=218 residues).
MSYNNRELVEHFLRYKLSQRNYPTSLLRPEDTDGRTEGEKRSPGASNGLLVRSRNRGGASPSAGAGIEAVNAALRDSAEE
FEKLFAQAFSDLSSQLDITPDTAYQSFKNVMDEVFKDGVNWGRVVGLFAFGGVLCVECVEKDASQLVCRIADWMTIYLDE
HINPWIQSQGGWDCFAKIFGDDAAAEGRRARENLSRWMLGGLALLMGVLVGAFIVKKH
>gnl|bcl2dbpro|H3CH49_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Tetraodon nigroviridis GN=BCL2L1 (length=232 residues).
RSHPGAKSKGASTQRMSLNRELVIFYIKYKLSQRNYPLSHIVEPSSRTEGQFGTTQSNGTFNGASPGTPPAPSQHQQSLT
SLDAVKEALRDTGNEFELRYTCAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMNP
LVGRIIEWMTVYLDNHIQPWIQSQGGWERFAELFGQDAAAESRRSQERFRNGLFLGMSLAAGIALGSFIVMR
>gnl|bcl2dbpro|A0A2U3V0P1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Tursiops truncatus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVDENRTEAPEGTESDMETPSAINGNPSWHLADSPAVNVATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVLLLGSLFSRK
>gnl|bcl2dbpro|A0A452SDS4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Ursus americanus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A384D3U1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Ursus maritimus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|Q2TAP5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Xenopus laevis GN=BCL2L1 (length=204 residues).
MEGSSRDLVEKFVSKKLSQNEACRKFSNNPQPNAISNGTSTSERPGEGATQGIVEEEVLQALLEATEEFELRYQRAFSDL
TSQLHITQDTAQQSFQQVMGELFRDGTNWGRIVAFFSFGRALCVESANKEMTDLLPRIVQWMVNYLEHTLQPWMQENGGW
EAFVGLYGKNAAAQSRESQERFGRLLTIVILTGVFALVCYMRRR
>gnl|bcl2dbpro|Q91828_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Xenopus laevis GN=BCL2L1 (length=204 residues).
MEGSSRDLVEKFVSKKLSQNEACRKFSNNPNPMPYLMEPSTSERPGEGATQGIVEEEVLQALLEATEEFELRYQRAFSDL
TSQLHITQDTAQQSFQQVMGELFRDGTNWGRIVAFFSFGRALCVESANKEMTDLLPRIVQWMVNYLEHTLQPWMQENGGW
EAFVGLYGKNAAAQSRESQERFGRLLTIVMLTGVFALVCYMRRR
>gnl|bcl2dbpro|Q6GLI5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Xenopus tropicalis GN=BCL2L1 (length=201 residues).
MEGSSRDLVEKFVCKKLSQKGACGEFSSNSQPKGVSNGSSEGPGATQGIVGEEVLQALLDASEEFELRYQRAFSDLTAQL
HLTQDTAQQSFQQVVGELFRDGTNWGRIVAFFSFGRALCVESANKEMTELLPRIVQWMVQYLEHTLQPWMLENGGWEAFV
GLYGKGAAAQSREGPERFGRWLMAIVTVTAATLLVSYLRRR
>gnl|bcl2dbpro|A0A3B5MGS2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Xiphophorus couchianus GN=BCL2L1 (length=219 residues).
MAYSNRELVEFYISYKLSQRNYSSSLLRSEVAGGRTNWEGDSRVPRNGPLVNSWAGHPGKPRGPPAGVEVVKSVLKDAAE
EFERLYTQSFKHLSLQLDITPDTAYHSFKTVLDELFKGGVNWGRVVAMFTFGGILCVDCVQKNMSELVSRIAEWMTTYLD
EQLSPWIQSQGGWDRFANLYGQDAAAEGRRFRETLNKWLLVGVALLTGALLVVFVAKKR
>gnl|bcl2dbpro|A0A3B5PQJ0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Xiphophorus maculatus GN=BCL2L1 (length=227 residues).
MSRNRELVLFYIKFKLSQRNYPIQHILPNEPPDGTAAGDVGMDDEQTLETHANGTFNGTSPGSPRRHQAASASTMDAVKV
ALRDTAREFELRYSRAFNDLHSTLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSHLVARIVE
WMTVYLDEQIEPWVESQGGWERFAEIFGGNAAAESRRSQESFKNWLLLGMSVVTAFIAGSIFAQKRL
>gnl|bcl2dbpro|M4A558_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Xiphophorus maculatus GN=BCL2L1 (length=219 residues).
MAYSNRELVEFYISYKLSQRNYSSSLLRSEVAGGRTNWEGDSRVPSNGRLVNSRAGPPGKPRGPMAGVEVVKSVLKDAAE
EFERLYTQSFKHLSLQLDITPDTAYHSFKTVLDELFKGGVNWGRVVAMFTFGGILCVDCVQKNMSELVSRIAEWMTTYLD
EQLSPWIQSQGGWDRFANLYGQDAAAEGRRFRETLNKWLLVGVALLTGALLVVFVAKKR
© 1998-2019