Dataset for protein Bfl1 of organism all

[Download (right click)] [Alignment] [Repertoires]

82 sequence(s)

>gnl|bcl2dbpro|A0A2K5D2I1_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2A1 (length=175 residues).
MTDCEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSRVLQKVAFSVQKEVEKSLKPCLDNVNIVSIDNARMIFSQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWISQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYY
>gnl|bcl2dbpro|A0A2K5D2I1_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2A1 (length=163 residues).
MTDCEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSRVLQKVAFSVQKEVEKSLKPCLDNVNIVSIDNARMIFSQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWISQNGGWAKWHSLLLVLVESVAQKERK
MAL
>gnl|bcl2dbpro|Q3C2I0_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Bos taurus GN=BCL2A1 (length=175 residues).
MTDTEFGYVHGLAEDYLKYVLQIQQPGSKPSKTSRVLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFE
DGIVNWGRIVTIFAFEGILTKKLLGKCIASDMDMCKDISFFVAEFITENTGEWIKQNGGWENGFVKKFETKSGWLTFLEV
TGKICETLCRLKQYY
>gnl|bcl2dbpro|U3DBA0_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2A1 (length=162 residues).
MTDSEFGYIHNLTQDYLQYVLQIPQSGMGPSKTSRVLQQVAFSVQKEVEKSLKSCLDNVDIASIDNARTIFSQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISHFVAEFIMNNTGEWIRQNGGWGKWHSLMLMLVSVAQKKRKM
AL
>gnl|bcl2dbpro|U3DBA0_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2A1 (length=175 residues).
MTDSEFGYIHNLTQDYLQYVLQIPQSGMGPSKTSRVLQQVAFSVQKEVEKSLKSCLDNVDIASIDNARTIFSQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISHFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYC
>gnl|bcl2dbpro|E2RS00_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2A1 (length=174 residues).
MTDCEFGYTLALAQDYVRHVLQIPQPGPAPSRASRVLQDVAFSVQGQVEKNLKPCLDSFDVVSVDTARTIFNQVMEKEFE
DGVINWGRIVTVFAFEGILTKKLLEQRISSDVDAEKVSYFVAEFITRNMRDWIRQNGGWENGFVKKFEPKSGWLTFLEVL
GTVCEMWSHLKQYY
>gnl|bcl2dbpro|A0A452EK63_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Capra hircus GN=BCL2A1 (length=175 residues).
MTDTEFDYVHKLAEDYLKYVLQIQQPGSKPSKTSRVLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFE
DGIVNWGRIVTIFAFEGILTKKLLSKRIASDMDMCKDISYFVAEFITENTGEWIRQNGGWENGFVKKFETKSGWLTFLEV
TGKICETLCRLKQYY
>gnl|bcl2dbpro|A0A286XUI2_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Cavia porcellus GN=BCL2A1 (length=202 residues).
MGHILLSATAGSLDLREPAAGCCLPPRMIDLEFRYTQALAQDYLLHVLQVPQCETSPSKASKVLQDMALSVQEEVERRLK
PWLDRIDVESIDTAKSIFNQVMEKEFEDGIINWGRIVTIFAFGGVILKKLPREPIAPDVDTYKEISYFVAEFIMSRMGGW
IRQNGGWDNGFVRKFEPKSGWLTFVGVMGQLCEMLSLLKQFY
>gnl|bcl2dbpro|A0A2K5KHH9_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Cercocebus atys GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYC
>gnl|bcl2dbpro|A0A2K5KHH9_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Cercocebus atys GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKLEPKSGWMTFLEV
TGKICEMLSLLKQYC
>gnl|bcl2dbpro|A0A2K5KHH9_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Cercocebus atys GN=BCL2A1 (length=163 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHMPMLVESVAHRKKK
MAL
>gnl|bcl2dbpro|A0A0D9RRC3_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Chlorocebus sabaeus GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVASSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFITNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYC
>gnl|bcl2dbpro|A0A2K5KAB6_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQEEVEKNLKPCLDNVNVASIDTARTIFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYC
>gnl|bcl2dbpro|A0A2K5KAB6_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BCL2A1 (length=163 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQEEVEKNLKPCLDNVNVASIDTARTIFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHMPMLVESVAHKKKK
MAL
>gnl|bcl2dbpro|F7CP56_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Equus caballus GN=BCL2A1 (length=174 residues).
MTDCEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDIAFSVQNEVEKNLKPCLDNFHVVSIDAARTIFNQVMEKQFE
DGIINWGRIMTIFAFEGILIKKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWENGFVKKFEPKSGWLTFLEV
TGKMCEILFLKQYY
>gnl|bcl2dbpro|A0A337STN9_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Felis catus GN=BCL2A1 (length=144 residues).
MADGEFGYVLTLARDYTEHVLQGPQPGSHPSRVSQVLQDVAFSVQGEVEKKLKPCLDKFHVVSVDTARTIFHQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLQERIVPDADAFKVSYFVAEFITKHTGEWIRQNGGWHSVQV
>gnl|bcl2dbpro|A0A337STN9_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Felis catus GN=BCL2A1 (length=174 residues).
MADGEFGYVLTLARDYTEHVLQGPQPGSHPSRVSQVLQDVAFSVQGEVEKKLKPCLDKFHVVSVDTARTIFHQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLQERIVPDADAFKVSYFVAEFITKHTGEWIRQNGGWENGFVRKFEPKSGWLTFLEVT
GKICKVLSLLKNYY
>gnl|bcl2dbpro|U3JTB2_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Ficedula albicollis GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRTMASSLQDQTEEALRPLLDRIDITSVAVAKRIFNGVMDEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTAEEKEEISYFITEYIINNKSEWIDANGGWENGFLTKFERRSLLSFSKIT
ALFIAVVSLFREYY
>gnl|bcl2dbpro|Q9W6F2_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Gallus gallus GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRIDITSVDVAKRIFNGVMEEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTGEEKEKISYFITEYIINNKAAWIDANGGWENGFLTKFERRSPLSFSTIT
DIFAAVLSLFREYH
>gnl|bcl2dbpro|A0A452J3N6_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Gopherus agassizii GN=BCL2A1 (length=175 residues).
MESSEYCYVYYLVQDYLKYVLQEPQLGPAPSRVAHVLRHAASFLQKENEESLKPCLDTFDITSVDAARRIFTQVMDKEFA
DGNTNWGRILTIFMFGGILSKKLQEHRVQLTGENKKQISYFITEYIINTKAEWIEANGGWENGFLTMFEEKRSWLSLFNI
KAKIMDAFSFFSQYY
>gnl|bcl2dbpro|A0A2I2YML2_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2A1 (length=163 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKSCLDNVNVVSIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHTPMLVESVAHKKRK
MAL
>gnl|bcl2dbpro|A0A2I2YML2_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKSCLDNVNVVSIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYC
>gnl|bcl2dbpro|A0A2I2YML2_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2A1 (length=196 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKSCLDNVNVVSIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKISILLTRKDTPYCETGLIFLTVMETIANTYFYF
>gnl|bcl2dbpro|Q16548_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Homo sapiens GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYC
>gnl|bcl2dbpro|B4E1X9_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Homo sapiens GN=BCL2A1 (length=163 residues).
MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWVCVMEKFFIVLSCEIEIENF
LAS
>gnl|bcl2dbpro|Q16548_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Homo sapiens GN=BCL2A1 (length=163 residues).
MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHTPMLVESVAHKKRK
MAL
>gnl|bcl2dbpro|I3MCZ7_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BCL2A1 (length=175 residues).
MNDCEFRFIHTLAQDYLQHVLQVPQRGSSPSKTSKVLQNVAFSVQKEVEKNLKPFLDNFDVVSADTARTIFNQVMEKEFE
DGIMNWGRIVTIFAFGGVLVKKLLRERIAPAVDSDEEISYFVAEFIMNNAGEWIRQNGGWENGFVKKFEPKSGWLTFLGV
TGQICEMLSLLKQYY
>gnl|bcl2dbpro|G3T8E6_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Loxodonta africana GN=BCL2A1 (length=175 residues).
MTDCEFGYIYKLVQDYLKYVLQIPQPAAGSSKTSRVLQNVAFSVQKEVEKNLKPCLDNFVVISIDTAQTIFKQVMEKEFE
DGIINWGRIVTIFAFGGILIKKLLRERIAPDVDTYKKISSFVAEFIVDNTAEWIRQNGGWENGFVKKFEPRSGWLTFLEV
TGKICEMLFLLKQYY
>gnl|bcl2dbpro|A0A2K5TMD8_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYC
>gnl|bcl2dbpro|A0A2K5TMD8_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2A1 (length=162 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHMPMLVESVAHKKKM
AL
>gnl|bcl2dbpro|F7E8V5_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Macaca mulatta GN=BCL2A1 (length=156 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHMPMLVESVAH
>gnl|bcl2dbpro|F7E8V5_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Macaca mulatta GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYC
>gnl|bcl2dbpro|A0A2K6DS80_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Macaca nemestrina GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYC
>gnl|bcl2dbpro|A0A2K6DS80_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Macaca nemestrina GN=BCL2A1 (length=163 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHMPMLVESVAHKKKK
MAL
>gnl|bcl2dbpro|A0A2K6AD55_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Mandrillus leucophaeus GN=BCL2A1 (length=163 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHMPMLVESVAHRKKK
MAL
>gnl|bcl2dbpro|A0A2K6AD55_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mandrillus leucophaeus GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYC
>gnl|bcl2dbpro|G1N8C5_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Meleagris gallopavo GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESRLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRIDITSVDVAKRIFNGVMEEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEQGVQLTGEEKEQISYFITEYIINNKAAWIDANGGWENGFLTKFERRSPLSFSTIT
DIFAAVFSLFRDYY
>gnl|bcl2dbpro|F6SFL4_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Monodelphis domestica GN=BCL2A1 (length=172 residues).
MDDYEFHYVHMLARDYLKHVQQTPPLGSCLNKTSQILQKVAFSVQQEVEKDMETCLSTLDIVSVESARRIFNSVMKKEFE
DGVINWGRIVTIFAFGGILIKKLLRHRAPLTMGTQEEISHFIAEFIMNNIAEWIRQNGGWENGFVKNFEPNTVWPNFTDI
STKIWGIFSFLK
>gnl|bcl2dbpro|O55177_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Mus musculus GN=BCL2A1 (length=172 residues).
MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIRRNGGWEDGFIKKFEPKSGWLTFLQM
TGQFWEMLFLLK
>gnl|bcl2dbpro|O55178_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mus musculus GN=BCL2A1 (length=128 residues).
MAEYELMHIHSLAEHYLQYVLQVPAFESAPSQAFRVLQRVAFSVQKEVGKNLKSYLDDFHVESIDTTRIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKTSTRADCPGCTCLQTSFQFWGRIHNE
>gnl|bcl2dbpro|O55179_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mus musculus GN=BCL2A1 (length=172 residues).
MSEYEFMYIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIMNNTGEWIRRNGGWEDGFIKKFEPKSGWLTFLQM
TGQIWEMLFLLK
>gnl|bcl2dbpro|Q07440_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mus musculus GN=BCL2A1 (length=172 residues).
MAESELMHIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQIALDVCAYKQVSSFVAEFIMNNTGEWIRQNGGWEDGFIKKFEPKSGWLTFLQM
TGQIWEMLFLLK
>gnl|bcl2dbpro|Q0P538_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mus musculus GN=BCL2A1 (length=128 residues).
MAEYELMHIHSLAEHYLQYVLQVPAFESAPSQAFRVLQRVAFSVQKEVGKNLKSYLDDFHVESIDTTRIIFNQVMEKEFE
NGIINWGRIVTIFAFGGVLLKKTSTRADCPGCTCLQTSFQFWGRIHHE
>gnl|bcl2dbpro|Q497M6_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mus musculus GN=BCL2A1 (length=172 residues).
MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSKACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIRRNGGWEDGFIKKFEPKSGWLTFLQM
TGQFWEMLFLLK
>gnl|bcl2dbpro|Q4FK02_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mus musculus GN=BCL2A1 (length=172 residues).
MSEYEFMYIHSLAEHYLQYVLQVPAFESAPSKACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIRRNGGWEDGFIKKFEPKSGWLTFLQM
TGQFWEMLFLLK
>gnl|bcl2dbpro|Q8K164_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mus musculus GN=BCL2A1 (length=172 residues).
MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIRRNGGWEDGFIKKFEPKSGWLTFLQM
TGQIWEMLFLLK
>gnl|bcl2dbpro|M3YVH4_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mustela putorius furo GN=BCL2A1 (length=174 residues).
MTDSEFGYTLSLAQDYVRHVLQIPQPSPAASRVSRVLRDVASSVQGEVEQNLRPCLDSFDVGSIDTARTIFNQVMEKEFE
DGIINWGRIVTVFAFEGILSKKLLRERISPDVDASRVSYFVAEFITTNMREWIRQNGGWEDGFVKKFEPKSGWLTFLEVI
GKICEMFSLLKQYY
>gnl|bcl2dbpro|A0A2I3HNF3_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKPCLDNVNVVSIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILVKKLLRQRTAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSFLKQYC
>gnl|bcl2dbpro|A0A2I3HNF3_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2A1 (length=163 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKPCLDNVNVVSIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILVKKLLRQRTAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHMPMLVESVAHKKRK
MAL
>gnl|bcl2dbpro|A0A2I3HNF3_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2A1 (length=205 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKPCLDNVNVVSIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILVKKLLRQRTAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKISILLTRKDTPYCETGLIFLTLMETIANTYFYFKINNFDDVT
>gnl|bcl2dbpro|F6S8G3_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Ornithorhynchus anatinus GN=BCL2A1 (length=175 residues).
MDDGVFWSVRALALDYLDDVLQTPRLGTVPSRTSRALQNVMFSVQGDVEKALKPCFDSLDVGSVGAARRIFGQIVEKEFE
DGIVNWGRIVTIFVLGGILTKKLQRSGVPLTRETREEISCFIAEFTTHHAGEWIRQNGGWENGFLNKFEQKTVWSVLADI
SMKILGVLSHLKQFY
>gnl|bcl2dbpro|G1T1L8_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Oryctolagus cuniculus GN=BCL2A1 (length=199 residues).
MFASQGFGSFQKKQSPALLSEQQKMSDCEFGYVHTLAQDYLLYILKTPQPGLGPSKTSRVLQNVTFSIQQEVEEALQPYL
HNVPVASVETARTIFNQVMEKEFEDGVINWGRIVTIFAFEGVLAKKLLQEQAVPDVDTFKSIPYFVAEFITRRMGEWIRQ
NGGWENGFVKKFEHNSGWKIFLEVAKQICVILSLLKKYC
>gnl|bcl2dbpro|H0WZ23_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Otolemur garnettii GN=BCL2A1 (length=174 residues).
MTDCEFGYIHRLAQDYLQYVLQIQQCGSGPSKTSRVLQNVAFSVQEEVEKSLKPCLDNFNVVSIDTARTIFNQVMEKEFE
DGIINWGRIVTIFAFGGILLKKLLQQRIALDVDTYKEISYFVAEFIMNYTGEWIRQNGGWEHGFVKKFEPNSGYSGWLTF
LEVTRKICEMLPLL
>gnl|bcl2dbpro|W5Q0N6_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Ovis aries GN=BCL2A1 (length=175 residues).
MTDTEFDYVHKLAEDYLKYVLQIQQPGSKPSKTSRVLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFE
DGIVNWGRIVTIFAFEGILTKKLLSKRIASDMDMCKDISYFVAEFITKNTGEWIRQNGGWENGFVKKFETKSGWLTFLEV
TGKICETLCRLKQYY
>gnl|bcl2dbpro|A0A2R8ZJX9_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Pan paniscus GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSQTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEHKSGWMTFLEV
TGKICEMLSLLKQYC
>gnl|bcl2dbpro|A0A2R8ZJX9_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Pan paniscus GN=BCL2A1 (length=196 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSQTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEHKSGWMTFLEV
TGKISILLTRKDTPYCETGLIFLTVMETIANTYFYF
>gnl|bcl2dbpro|A0A2R8ZJX9_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Pan paniscus GN=BCL2A1 (length=163 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSQTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHTPMLVESVAHKKRK
MAL
>gnl|bcl2dbpro|A0A2I3T6T8_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Pan troglodytes GN=BCL2A1 (length=196 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEHKSGWMTFLEV
TGKISILLTRKDTPYCETGLIFLTVMETIANTYFYF
>gnl|bcl2dbpro|A0A2I3T6T8_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Pan troglodytes GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEHKSGWMTFLEV
TGKICEMLSLLKQYC
>gnl|bcl2dbpro|A0A2I3T6T8_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Pan troglodytes GN=BCL2A1 (length=163 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHTPMLVESVAHKKRK
MAL
>gnl|bcl2dbpro|A0A2I3T6T8_BCL2A1-04 BCL2-related protein A1 protein OS=[Eukaryota] Pan troglodytes GN=BCL2A1 (length=71 residues).
VARSWLTAASTSTAQENGFVKKFEHKSGWMTFLEVTGKISILLTRKDTPYCETGLIFLTVMETIANTYFYF
>gnl|bcl2dbpro|A0A096NMX5_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Papio anubis GN=BCL2A1 (length=163 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGLGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHMPMLVESVAHKKKK
MAL
>gnl|bcl2dbpro|A0A096NMX5_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Papio anubis GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGLGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYC
>gnl|bcl2dbpro|K7G130_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Pelodiscus sinensis GN=BCL2A1 (length=175 residues).
MESSEFRYVYYLVQDYLKYILQEPELGPAPSRVAHVLRNSASFLQKENEEILKPCLDTLDITSVDAARRIFIQVMDKEFD
DGNTNWGRILTIFMFGGILSKRLQEHKVQLTGDNKEQISYFITEYIINTKAEWIDANGGWENGFLPMFEEKQSWLSLFNI
KAKIMDAFSFFSQYY
>gnl|bcl2dbpro|H2NNZ9_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Pongo abelii GN=BCL2A1 (length=174 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKASRVLQKVAFSVQKEVEKNLKPCLDNVNVVSVDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFVMNNTGGWIKQNGGWENGFVKKLEPKSGWMTFEVT
GKICEMLSLLKQYC
>gnl|bcl2dbpro|A0A2K6EKG1_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Propithecus coquereli GN=BCL2A1 (length=173 residues).
MTDCEFGYTHRLVQDYLQYVLRVPQPGSGPSKTSRVLQNIAFSVQNEVEKNLKACLDNVNVASIDAARTIFNQVMEKEFE
DGIVNWGRIVTVFAFGGILIKKLLREQIALDVDTYKEISYFIAEFITNNAGEWIRQNGGWEHGFVKKFEPRPAWLTFLEV
TGKICDMLSLLYS
>gnl|bcl2dbpro|G3V977_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Rattus norvegicus GN=BCL2A1 (length=175 residues).
MTDCEFMYIHSLAENYLQYVLQVPAFESAPSKTSRVLQRVAFSVQKEVEKNLKPYLDDFHVESIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQIALDVDTYKQVSSFVAEFIMNNTGEWIQQNGGWEDGFTKKFEPKSGWLTFLQM
TGKIWEMLFLLKQHY
>gnl|bcl2dbpro|Q925A9_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Rattus norvegicus GN=BCL2A1 (length=175 residues).
MTDCEFMYIHSLAENYLQYVLQVPAFESAPSKTSRVLQRVAFSVQKEVEKNLKPYLDDFHVESIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQIGLDVDTYKQVSSFVAEFIMNNTGEWIQQNGGWEDGFTKKFEPKSGWLTFLQM
TGKIWEMLFLLKQHY
>gnl|bcl2dbpro|A0A2K6LV22_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYC
>gnl|bcl2dbpro|A0A2K6LV22_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2A1 (length=163 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHMPMLVESVAHRKKK
MAL
>gnl|bcl2dbpro|A0A2K6PHG5_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2A1 (length=163 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHMPMLVESVAHKKKK
MAL
>gnl|bcl2dbpro|A0A2K6PHG5_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYC
>gnl|bcl2dbpro|A0A2K6TLM0_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2A1 (length=175 residues).
MTDHEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSRVLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFSQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIRRNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYY
>gnl|bcl2dbpro|A0A2K6TLM0_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2A1 (length=162 residues).
MTDHEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSRVLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFSQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIRRNGGWGKWNSLMLMLVESAQKKKKM
AL
>gnl|bcl2dbpro|A0A2K6TLM0_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2A1 (length=144 residues).
MTDHEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSRVLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFSQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIRRNGGWDLSQ
>gnl|bcl2dbpro|G3WSP8_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL2A1 (length=172 residues).
MADCEFHYVHMLAQDYLKHVQQMPRLGSCLHRTSQILQKVAFSVQEEVEKDMETFLSTLDITSVDCARRIFNSVMEKEFE
DGIINWGRIVTIFAFGGILIKKLLRHRAPLTMDTHEEISHFIAEFIMNNIAEWIRQNGGWENGFIKNFEPNMVWPNFTDI
STKIWNVFSFLK
>gnl|bcl2dbpro|C7F841_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Sus scrofa GN=BCL2A1 (length=175 residues).
MTDDEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLRDVAFSVQNEVEKNLKPCLDNFDVVSIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFEGILMKKLLRKRIAPDVDTYKEISYFVAEFITKNTGQWIRQNGGWENGFVKKFEPKSGWLTFVEV
TGKICEMLCLLKQYY
>gnl|bcl2dbpro|C7F841_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Sus scrofa GN=BCL2A1 (length=175 residues).
MTDDEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLRDVAFSVQNEVEKNLKPCLDNFDVVSIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFEGILMKKLLRKRIAPDVDTYKEISYFVAEFITKNTGQWIRQNGGWENGFVKKFEPKSGWLTFVEV
TGKICEMLCLLKQYY
>gnl|bcl2dbpro|H0ZCL9_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Taeniopygia guttata GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRTMASSLQDQTEEAVRPLLDRIDITSVAAAKRIFNGVMDEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTAEEKEQISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSKIT
ALFIALVSLFREYY
>gnl|bcl2dbpro|A0A452SIR9_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Ursus americanus GN=BCL2A1 (length=174 residues).
MTDCEFGYTLTLAQDYVKHVLQIPQPGSAPSRASQVLRDVASSVQGEVEKNLKPCLDSFDVVSVDSARTIFNQVMEKEFE
DGIINWGRIVTIFAFEGILTKKLLQERISPDVDASRISYFVAEFITTNMREWIRQNGGWEDGFVKKFEPKSGWLTFLEVT
GKICEMFSLLKQYY
>gnl|bcl2dbpro|A0A452U2H8_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Ursus maritimus GN=BCL2A1 (length=216 residues).
MHTEIPPASARPMSHRPSPAGARLIWPXXXXXXXXXXGGWKMTDCEFGYTLTLAQDYVKHVLQIPQPGSAPSRASQVLRD
VASSVQGEVEKNLKPCLDSFDVVSVDSARTIFNQVMEKEFEDGIINWGRIVTIFAFEGILTKKLLQERISPDVDASRISY
FVAEFITTNMREWIRQNGGWSLLPPSASVKGCKRRAPGRSERRAAATFSAGSSVRE
>gnl|bcl2dbpro|A0A452U2H8_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Ursus maritimus GN=BCL2A1 (length=215 residues).
MHTEIPPASARPMSHRPSPAGARLIWPXXXXXXXXXXGGWKMTDCEFGYTLTLAQDYVKHVLQIPQPGSAPSRASQVLRD
VASSVQGEVEKNLKPCLDSFDVVSVDSARTIFNQVMEKEFEDGIINWGRIVTIFAFEGILTKKLLQERISPDVDASRISY
FVAEFITTNMREWIRQNGGWEDGFVKKFEPKSGWLTFLEVMGKICEMFSLLKQYY
© 1998-2019