Dataset for protein Unclassified of organism Zootermopsis nevadensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A067RGX7_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Zootermopsis nevadensis (length=131 residues).
MLDKHVLLFTSFAKRLARTPENISEQFLVVSEELFQDCVTWSRIIALYALAGRLALYYRENNMQKLAESIPQCMAHCIAG
KIASFVIKNGGWEQLCVEFPPKKDLSVKVWRSLLVTGAALGIVAALLMVHS
© 1998-2019