Dataset for protein Unclassified of organism Xiphophorus maculatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3B5QUY0_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Xiphophorus maculatus (length=229 residues).
MANDYNRIIVENYICHKLSKRGYVWGFNGVPDDDAANNGGLGDHSPTLVRRCRDAGPGPDSDSDPHRLCRRISQSDPYAD
IHRVLRDAGDELEKLYQLDFVEMSQQLYLTRDTARTRFAEVINELFRDGVNWGRIIAFFEFGSTVCVECASKEEMTSQVD
NIAEWMTEYLNGPLDSWIQDNGGWEAFVELYDRQKESVFSCYWPSIKTVFGLAALGAASVTIGAYLAQK
© 1998-2019