Dataset for protein BCL-2-like of organism Xiphophorus maculatus

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A3B5PQ55_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Xiphophorus maculatus GN=MCL-1 (length=275 residues).
MTANSTNALNYLIFSQNGVGNGQTHYDQGLGVPEVAMGSTVESLHSPKDPFMKRPTNLGVNGYVAKSLPTSSDDSDEGSL
PCTPAQHPDSEKDATAVGASNQVLDNDTTELISSFLRDFTGLSKCRWGQNKALSTMKRVVEDLLSKHKYAYNGMVNRLAL
DNEPDDMEFVTEIAESLFSDGITNWGRIASLVTFGAAVCQRLKERGREHCVELVSRKISTYLLANQRDWLAKNNSWEGFV
EFFRVSDPESTVRNTLMAVVGVAGIGATLAFLISF
>gnl|bcl2dbpro|A0A3B5PQ55_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Xiphophorus maculatus GN=MCL-1 (length=280 residues).
MTANSTNALNYLIFSQNGVGNGQTHYDQGLGVPEVAMGSTVESLHSPKDPFMKRPTNLGVNGYVAKSLPTSSDDSDEGSL
PCTPAQHPDSEKDATAVGASNQVLDNDTTELISSFLRDFTGLSKCRWGQNKALSTMKRVVEDLLSKHKYAYNGMVNRLAL
DNEPDDMEFVTEIAESLFSDGITNWGRIASLVTFGAAVCQRLKERGREHCVELVSRKISTYLLANQRDWLAKNNSWEGFV
EFFRVSDPESTVRNTLMAVVGVAGIGATLAFLIRRCKEKY
>gnl|bcl2dbpro|A0A3B5PQJ0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Xiphophorus maculatus GN=BCL2L1 (length=227 residues).
MSRNRELVLFYIKFKLSQRNYPIQHILPNEPPDGTAAGDVGMDDEQTLETHANGTFNGTSPGSPRRHQAASASTMDAVKV
ALRDTAREFELRYSRAFNDLHSTLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSHLVARIVE
WMTVYLDEQIEPWVESQGGWERFAEIFGGNAAAESRRSQESFKNWLLLGMSVVTAFIAGSIFAQKRL
>gnl|bcl2dbpro|M4A558_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Xiphophorus maculatus GN=BCL2L1 (length=219 residues).
MAYSNRELVEFYISYKLSQRNYSSSLLRSEVAGGRTNWEGDSRVPSNGRLVNSRAGPPGKPRGPMAGVEVVKSVLKDAAE
EFERLYTQSFKHLSLQLDITPDTAYHSFKTVLDELFKGGVNWGRVVAMFTFGGILCVDCVQKNMSELVSRIAEWMTTYLD
EQLSPWIQSQGGWDRFANLYGQDAAAEGRRFRETLNKWLLVGVALLTGALLVVFVAKKR
>gnl|bcl2dbpro|M4AUW7_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Xiphophorus maculatus GN=BCL2L10 (length=194 residues).
MSCGLWKETVVVAEDYIRLRCSSPHPAPPPPSEPAAAMRRLAQDVEAKHQARFHSLAQGFLKHCGSDLCSNLRKVMDEMV
GDGHFNWGRVVSLFAFAGVLARQLREQTGKNPVPDSGKQQELQQEPVSCRALAETIADYLEKHKKDWLQENNGWEGFCSY
ARNAREASQDSSMKTALVAVAGVGIAGLTFLLVR
© 1998-2019