Dataset for protein Unclassified of organism Xiphophorus couchianus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3B5MJB9_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Xiphophorus couchianus (length=212 residues).
MANDYNRIIVENYICHKLSKRGYVWGFNGVPDDDAANNGGLGDHSPTLVRRCRDAGPGPDRDSDPHSLCRRISQSDPYAD
IHRVLRDAGDELEKLYQLDFVEMSQQLYLTRDTARTRFAEVINELFRDGVNWGRIIAFFEFGSTVCVECASKEEMTSQVD
NIAEWMTEYLNGPLDSWIQDNGGWVGLIQPLKLGALWLYLQLRTESTREIGH
© 1998-2019