Dataset for protein BCL-2-like of organism Xiphophorus couchianus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3B5MGS2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Xiphophorus couchianus GN=BCL2L1 (length=219 residues).
MAYSNRELVEFYISYKLSQRNYSSSLLRSEVAGGRTNWEGDSRVPRNGPLVNSWAGHPGKPRGPPAGVEVVKSVLKDAAE
EFERLYTQSFKHLSLQLDITPDTAYHSFKTVLDELFKGGVNWGRVVAMFTFGGILCVDCVQKNMSELVSRIAEWMTTYLD
EQLSPWIQSQGGWDRFANLYGQDAAAEGRRFRETLNKWLLVGVALLTGALLVVFVAKKR
>gnl|bcl2dbpro|A0A3B5MJ12_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Xiphophorus couchianus GN=BCL2L10 (length=194 residues).
MSCGLWKETVVVAEDYIRLRCSSPHPAPPPPSEPAAAMRRLAQDVEAKHQARFHSLAQGFLKHCGSDLCSNLRKVMDEMV
GDGHFNWGRVVSLFAFAGVLARQLREQTGKNPVPDSGKQQELQQEPVSCRALAETIADYLEKHKKDWLQENNGWEGFCSY
ARNAREASQDSSMKTALVAVAGVGIAGLTFLLVR
© 1998-2019