Dataset for protein BCL-2-like of organism Xenopus tropicalis

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|F6TEC3_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Xenopus tropicalis GN=BCL2L2 (length=225 residues).
RKKGNNGVKDRDWEEQHATGNIIFRGSPDKYLTEQGWMAQSELGSRALVEDFVRYKLCQRSLVPEPAGAASCSLHSAMRA
AGDEFEERFRQAFSEISTQIHVTPGTAYARFAEVAGSLFQGGVNWGRIVAFFVFGAALCAESVNKEMSPLLPRIQDWMVT
YLETNLRDWIQSNGGWNGFLTLYGDGAIEEARRQREGNWASLKTVLTGAVALGALMTVGALFASK
>gnl|bcl2dbpro|F7BXJ7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Xenopus tropicalis GN=BCL-2 (length=191 residues).
MAHPRRGGYDHRDIVVKYIHYKLSQKGYEWEEGRQQVSAEHPQASAAISNYSDDGEMPAASADSRGPPQSSLASAAASSA
AMQPVPPAVLQTLSRAGDEFSRLYQQDFRQISGLLHLTPSTVRVRFATVVEELFHDGVNWGRIVAFFEFGGVMCVESVNR
EMSPLVDSIVGWMTEYLNSHLQNWIQEQGGW
>gnl|bcl2dbpro|F7ETY1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Xenopus tropicalis GN=MCL-1 (length=283 residues).
MMRQSVIAKQRTSAGFLIPCQFYCSGGGGGNASEKAVNDRGASPWDADMEAHRDKLDRPQLNGFGFNSGGSLTASQEGEL
DEDIDGGSQGSSSPPDSPVCPKDGLYMDTQQLILAFFRGYCGEETSGLKASFLLHHGAHPKALETLQRVGGDIIEKHHMA
FTGMLQRLSIHSREDLQKLSEVPALVFNDGVTNWGRIVTVISFGAFVAKHLKSIDLEDCIMALAEHFTLFLMTSKKDWII
QEKGWEGFVDFFHIEDYESGLRTVLMAFSSVAVLGAGLAFMIR
>gnl|bcl2dbpro|Q5XGJ4_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Xenopus tropicalis GN=BCL2L2 (length=188 residues).
MAQSELGSRALVEDFVRYKLCQRSLVPEPAGAASCSLHSAMRAAGDEFEERFRQAFSEISTQIHVTPGTAYARFAEVAGS
LFQGGVNWGRIVAFFVFGAALCAESVNKEMSPLLPRIQDWMVTYLETNLRDWIQSNGGWNGFLTLYGDGAIEEARRQREG
NWASLKTVLTGAVALGALMTVGALFASK
>gnl|bcl2dbpro|Q6GLI5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Xenopus tropicalis GN=BCL2L1 (length=201 residues).
MEGSSRDLVEKFVCKKLSQKGACGEFSSNSQPKGVSNGSSEGPGATQGIVGEEVLQALLDASEEFELRYQRAFSDLTAQL
HLTQDTAQQSFQQVVGELFRDGTNWGRIVAFFSFGRALCVESANKEMTELLPRIVQWMVQYLEHTLQPWMLENGGWEAFV
GLYGKGAAAQSREGPERFGRWLMAIVTVTAATLLVSYLRRR
© 1998-2019