Dataset for protein Bcl-w of organism Xenopus tropicalis

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|F6TEC3_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Xenopus tropicalis GN=BCL2L2 (length=225 residues).
RKKGNNGVKDRDWEEQHATGNIIFRGSPDKYLTEQGWMAQSELGSRALVEDFVRYKLCQRSLVPEPAGAASCSLHSAMRA
AGDEFEERFRQAFSEISTQIHVTPGTAYARFAEVAGSLFQGGVNWGRIVAFFVFGAALCAESVNKEMSPLLPRIQDWMVT
YLETNLRDWIQSNGGWNGFLTLYGDGAIEEARRQREGNWASLKTVLTGAVALGALMTVGALFASK
>gnl|bcl2dbpro|Q5XGJ4_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Xenopus tropicalis GN=BCL2L2 (length=188 residues).
MAQSELGSRALVEDFVRYKLCQRSLVPEPAGAASCSLHSAMRAAGDEFEERFRQAFSEISTQIHVTPGTAYARFAEVAGS
LFQGGVNWGRIVAFFVFGAALCAESVNKEMSPLLPRIQDWMVTYLETNLRDWIQSNGGWNGFLTLYGDGAIEEARRQREG
NWASLKTVLTGAVALGALMTVGALFASK
© 1998-2019