Dataset for protein Bcl-xL of organism Xenopus tropicalis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q6GLI5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Xenopus tropicalis GN=BCL2L1 (length=201 residues).
MEGSSRDLVEKFVCKKLSQKGACGEFSSNSQPKGVSNGSSEGPGATQGIVGEEVLQALLDASEEFELRYQRAFSDLTAQL
HLTQDTAQQSFQQVVGELFRDGTNWGRIVAFFSFGRALCVESANKEMTELLPRIVQWMVQYLEHTLQPWMLENGGWEAFV
GLYGKGAAAQSREGPERFGRWLMAIVTVTAATLLVSYLRRR
© 1998-2019