Dataset for protein Bcl-2 of organism Xenopus tropicalis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|F7BXJ7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Xenopus tropicalis GN=BCL-2 (length=191 residues).
MAHPRRGGYDHRDIVVKYIHYKLSQKGYEWEEGRQQVSAEHPQASAAISNYSDDGEMPAASADSRGPPQSSLASAAASSA
AMQPVPPAVLQTLSRAGDEFSRLYQQDFRQISGLLHLTPSTVRVRFATVVEELFHDGVNWGRIVAFFEFGGVMCVESVNR
EMSPLVDSIVGWMTEYLNSHLQNWIQEQGGW
© 1998-2019