Dataset for protein Mcl-1 of organism Xenopus laevis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|B6V6J0_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Xenopus laevis GN=MCL-1 (length=275 residues).
MMHQSVIAKQRPSTSFLIPCQFYCSGGGSSEKTLSARGASPWDPDMDTHRPQLNGLGFNNGGSLPCSQEDELDEDMDNGS
QGSTSPPDSPVCPKDGLYMDTQQLILAFYRVYSGEESGELEASCLLQHGVHHKALETLLRVGGEIIEKHHMAFTGMLQRL
SIHSREDLQKLSEVPALVFNDGVTNWGRIVTVISFGAFVAKHLKSLNLEDCIGVLAEHFTQFLMMSKKDWIIQEKGWDGF
VDFFHIEDYESGLKTVLMAFSSVAVLGAGLAYMIR
© 1998-2019