Dataset for protein BCL-2-like of organism Xenopus laevis

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|B6V6J0_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Xenopus laevis GN=MCL-1 (length=275 residues).
MMHQSVIAKQRPSTSFLIPCQFYCSGGGSSEKTLSARGASPWDPDMDTHRPQLNGLGFNNGGSLPCSQEDELDEDMDNGS
QGSTSPPDSPVCPKDGLYMDTQQLILAFYRVYSGEESGELEASCLLQHGVHHKALETLLRVGGEIIEKHHMAFTGMLQRL
SIHSREDLQKLSEVPALVFNDGVTNWGRIVTVISFGAFVAKHLKSLNLEDCIGVLAEHFTQFLMMSKKDWIIQEKGWDGF
VDFFHIEDYESGLKTVLMAFSSVAVLGAGLAYMIR
>gnl|bcl2dbpro|B9ZYL7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Xenopus laevis GN=BCL-2 (length=294 residues).
MAHPRRGGYDHRDIVVKYIHYKLSQKGYAWEEGRQQVSAEHPQASAAISNYSDDGEMPAASADSRGPPQSSLASAASSDE
ETPSNTPITFVGNAPAVPRRSASAVSPLAELNVEPRDLNVNPDASRAADGDNNDADGGDEAVMQPVPSAVLQTLSRAGDE
FSRLYQQDFRQISGLLHLTPSTVRVRFATVVEELFHDGVNWGRIVAFFEFGGVMCVEIVNREMSPLVDSIVGWMTEYLNR
HLQNWIQEQDAFVELYNSNIQPPFDQSWLSIKTILSLAVVGACITIGGISLATK
>gnl|bcl2dbpro|Q2TAP5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Xenopus laevis GN=BCL2L1 (length=204 residues).
MEGSSRDLVEKFVSKKLSQNEACRKFSNNPQPNAISNGTSTSERPGEGATQGIVEEEVLQALLEATEEFELRYQRAFSDL
TSQLHITQDTAQQSFQQVMGELFRDGTNWGRIVAFFSFGRALCVESANKEMTDLLPRIVQWMVNYLEHTLQPWMQENGGW
EAFVGLYGKNAAAQSRESQERFGRLLTIVILTGVFALVCYMRRR
>gnl|bcl2dbpro|Q91828_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Xenopus laevis GN=BCL2L1 (length=204 residues).
MEGSSRDLVEKFVSKKLSQNEACRKFSNNPNPMPYLMEPSTSERPGEGATQGIVEEEVLQALLEATEEFELRYQRAFSDL
TSQLHITQDTAQQSFQQVMGELFRDGTNWGRIVAFFSFGRALCVESANKEMTDLLPRIVQWMVNYLEHTLQPWMQENGGW
EAFVGLYGKNAAAQSRESQERFGRLLTIVMLTGVFALVCYMRRR
© 1998-2019