Dataset for protein Bcl-xL of organism Xenopus laevis

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|Q2TAP5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Xenopus laevis GN=BCL2L1 (length=204 residues).
MEGSSRDLVEKFVSKKLSQNEACRKFSNNPQPNAISNGTSTSERPGEGATQGIVEEEVLQALLEATEEFELRYQRAFSDL
TSQLHITQDTAQQSFQQVMGELFRDGTNWGRIVAFFSFGRALCVESANKEMTDLLPRIVQWMVNYLEHTLQPWMQENGGW
EAFVGLYGKNAAAQSRESQERFGRLLTIVILTGVFALVCYMRRR
>gnl|bcl2dbpro|Q91828_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Xenopus laevis GN=BCL2L1 (length=204 residues).
MEGSSRDLVEKFVSKKLSQNEACRKFSNNPNPMPYLMEPSTSERPGEGATQGIVEEEVLQALLEATEEFELRYQRAFSDL
TSQLHITQDTAQQSFQQVMGELFRDGTNWGRIVAFFSFGRALCVESANKEMTDLLPRIVQWMVNYLEHTLQPWMQENGGW
EAFVGLYGKNAAAQSRESQERFGRLLTIVMLTGVFALVCYMRRR
© 1998-2019