Dataset for protein BCL-2-like of organism Ursus maritimus

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A384D3U1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Ursus maritimus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A452T603_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Ursus maritimus GN=BCL-2 (length=177 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYDPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELF
RDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWVGARPLECASGLHVSNLRLRIRG
WSVGGLLGQGQTDEPGK
>gnl|bcl2dbpro|A0A452U285_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Ursus maritimus GN=BCL2A1 (length=215 residues).
MHTEIPPASARPMSHRPSPAGARLIWPXXXXXXXXXXGGWKMTDCEFGYTLTLAQDYVKHVLQIPQPGSAPSRASQVLRD
VASSVQGEVEKNLKPCLDSFDVVSVDSARTIFNQVMEKEFEDGIINWGRIVTIFAFEGILTKKLLQERISPDVDASRISY
FVAEFITTNMREWIRQNGGWEDGFVKKFEPKSGWLTFLEVMGKICEMFSLLKQYY
>gnl|bcl2dbpro|A0A452U285_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Ursus maritimus GN=BCL2A1 (length=216 residues).
MHTEIPPASARPMSHRPSPAGARLIWPXXXXXXXXXXGGWKMTDCEFGYTLTLAQDYVKHVLQIPQPGSAPSRASQVLRD
VASSVQGEVEKNLKPCLDSFDVVSVDSARTIFNQVMEKEFEDGIINWGRIVTIFAFEGILTKKLLQERISPDVDASRISY
FVAEFITTNMREWIRQNGGWSLLPPSASVKGCKRRAPGRSERRAAATFSAGSSVRE
>gnl|bcl2dbpro|A0A452UF16_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Ursus maritimus GN=BCL2L2 (length=331 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RGRARATSWFL
>gnl|bcl2dbpro|A0A452UF16_BCL2L2-03 BCL2-like 2 protein OS=[Eukaryota] Ursus maritimus GN=BCL2L2 (length=333 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RGRARATSWYSPY
© 1998-2019