Dataset for protein Bfl1 of organism Ursus maritimus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A452U2H8_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Ursus maritimus GN=BCL2A1 (length=216 residues).
MHTEIPPASARPMSHRPSPAGARLIWPXXXXXXXXXXGGWKMTDCEFGYTLTLAQDYVKHVLQIPQPGSAPSRASQVLRD
VASSVQGEVEKNLKPCLDSFDVVSVDSARTIFNQVMEKEFEDGIINWGRIVTIFAFEGILTKKLLQERISPDVDASRISY
FVAEFITTNMREWIRQNGGWSLLPPSASVKGCKRRAPGRSERRAAATFSAGSSVRE
>gnl|bcl2dbpro|A0A452U2H8_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Ursus maritimus GN=BCL2A1 (length=215 residues).
MHTEIPPASARPMSHRPSPAGARLIWPXXXXXXXXXXGGWKMTDCEFGYTLTLAQDYVKHVLQIPQPGSAPSRASQVLRD
VASSVQGEVEKNLKPCLDSFDVVSVDSARTIFNQVMEKEFEDGIINWGRIVTIFAFEGILTKKLLQERISPDVDASRISY
FVAEFITTNMREWIRQNGGWEDGFVKKFEPKSGWLTFLEVMGKICEMFSLLKQYY
© 1998-2019