Dataset for protein Bcl-2 of organism Ursus maritimus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A452T603_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Ursus maritimus GN=BCL-2 (length=177 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYDPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELF
RDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWVGARPLECASGLHVSNLRLRIRG
WSVGGLLGQGQTDEPGK
© 1998-2019