Dataset for protein BCL-2-like of organism Ursus americanus

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A452QJG0_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Ursus americanus GN=BCL2L10 (length=197 residues).
MADALRERTARLLTDYLEYCAREPGTPARAPSTPEAAVLRSVAAQVQQRHEHFLSDYRGYGGNRVELVAQVEREILAHPQ
PLSWGRVVALLTFAGTLLERSPSGTYSNLGPDQELELGEREAGVRQDCRHLVDFLCNRLTGQHRAWLEAHDGWVNGFCLF
FTPMLAVRLGKDCWPRLFCPASQAVILIYFWKRLCEF
>gnl|bcl2dbpro|A0A452R145_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Ursus americanus GN=BCL-2 (length=163 residues).
MPETRAPRPRGPPPRRASSPPSLGSPPRPPGPRRLPPPAAPAAAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAE
MSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGG
WAH
>gnl|bcl2dbpro|A0A452R145_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Ursus americanus GN=BCL-2 (length=205 residues).
MPETRAPRPRGPPPRRASSPPSLGSPPRPPGPRRLPPPAAPAAAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAE
MSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGG
WDAFVELYGPSMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A452RHX5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Ursus americanus GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGAASSGGRLLASGKEATARREVGGGEAGAVIGGSAGASPPATLAPDARRVARPS
PIGAEGPDVTATPPRLLFLEPTRRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASGGPCTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A452SDS4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Ursus americanus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A452SHI1_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Ursus americanus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A452SIR9_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Ursus americanus GN=BCL2A1 (length=174 residues).
MTDCEFGYTLTLAQDYVKHVLQIPQPGSAPSRASQVLRDVASSVQGEVEKNLKPCLDSFDVVSVDSARTIFNQVMEKEFE
DGIINWGRIVTIFAFEGILTKKLLQERISPDVDASRISYFVAEFITTNMREWIRQNGGWEDGFVKKFEPKSGWLTFLEVT
GKICEMFSLLKQYY
© 1998-2019