Dataset for protein Bcl-xL of organism Ursus americanus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A452SDS4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Ursus americanus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
© 1998-2019