Dataset for protein Bfl1 of organism Ursus americanus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A452SIR9_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Ursus americanus GN=BCL2A1 (length=174 residues).
MTDCEFGYTLTLAQDYVKHVLQIPQPGSAPSRASQVLRDVASSVQGEVEKNLKPCLDSFDVVSVDSARTIFNQVMEKEFE
DGIINWGRIVTIFAFEGILTKKLLQERISPDVDASRISYFVAEFITTNMREWIRQNGGWEDGFVKKFEPKSGWLTFLEVT
GKICEMFSLLKQYY
© 1998-2019