Dataset for protein Bcl-2 of organism Ursus americanus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A452R145_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Ursus americanus GN=BCL-2 (length=163 residues).
MPETRAPRPRGPPPRRASSPPSLGSPPRPPGPRRLPPPAAPAAAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAE
MSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGG
WAH
>gnl|bcl2dbpro|A0A452R145_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Ursus americanus GN=BCL-2 (length=205 residues).
MPETRAPRPRGPPPRRASSPPSLGSPPRPPGPRRLPPPAAPAAAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAE
MSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGG
WDAFVELYGPSMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
© 1998-2019