Dataset for protein Unclassified of organism Urechis unicinctus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A144KBE2_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Urechis unicinctus (length=234 residues).
MDVTDSVIVPERFSLQKNNNYSQRNGFTTTDRPILKAESKSKMVSITTNLEQSTQTPKSLNVDNVKQVAKELAVDIVNYV
SGHKHSKPVNQHAITLRRTVDELSEKHEIVFNSIVKKLQPLTRDTAVQTFFNVMDEMFRDCSYNWGRVVSVYAFGGRLAK
HFVDIKATDFVEKVAECLGTFVAEKLSKWIHQQGGWDAFDAYFPERSSMETVIWKSLVMTAFGLGALATMVAVR
© 1998-2019