Dataset for protein BCL-2-like of organism Tursiops truncatus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A2U3V0P1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Tursiops truncatus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVDENRTEAPEGTESDMETPSAINGNPSWHLADSPAVNVATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVLLLGSLFSRK
>gnl|bcl2dbpro|A0A2U3V2H3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Tursiops truncatus GN=MCL-1 (length=351 residues).
MFGLKRNAVIGLNLYCGGAGLGPDSGSGASAPGRRLLAAGKEATAGREVGGGEAGEVIGGSAGPSPPATLAPDARRVARP
SPIGAEGPDVTATRARLLFFAPTRRASPPEEMESSVSDAIMSPEEELDGCEPEPLGKRPSVLPLLELVGEASNSPGKDGS
LPSTPPPAEEEEDELYRQSLEIISRYLREQATGTKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN
EDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVDFF
HVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2U4BHU7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Tursiops truncatus GN=BCL-2 (length=233 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGVAGATSPGAAPAPGIFSSQPGSTPAPSRTSPPPPQTAPAAPAGGPAL
SPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREM
SPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A2U4CFE3_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Tursiops truncatus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
© 1998-2019