Dataset for protein Unclassified of organism Trichoplax adhaerens

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A1B1IJN9_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Trichoplax adhaerens (length=211 residues).
MTSSFDEASSQKIKTLKPTLTNFKGTNGFLDDEQFLVYKNIIKDYIQSRLLNEGLLDGPYRCDIKDVKTKKVSERLKEVG
NELEGKFKDSFSNMCERLTITDTTAYPTFVGVVNELFSTGINWGRIVAFIVFSSRLAIHFKRNGMPEYVKSVYGWVARYM
HTKLSTWIEANRSWDGFLDHFDKKNENEKSSIFTATMAVAIGTCAYFLFNR
>gnl|bcl2dbpro|B3RSA4_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Trichoplax adhaerens (length=215 residues).
MSPEREKMVETNIANSESTENYANGTSYLQPVNDEEMCRESRQLAYDFVYEVVGEKNPVSYIRKRSSSRCIKKLNRMTKV
MLERHDIPFKSACTKMKLSKDAPVRRMLQSIAAEMFRNGCNWGRITALFALCRKLAINSKELGYYDIIYKIAGCLADILT
GQLHSWIAAKGGWDEYVSYFRDTEDVQEDAKKFLMYTTLALTASFAVALAVWERW
© 1998-2019