Dataset for protein Unclassified of organism Tetraodon nigroviridis

[Download (right click)]

4 sequence(s)

>gnl|bcl2dbpro|H3C1U2_uncBCL2L10-01 Putative BCL2-like 10 protein OS=[Eukaryota] Tetraodon nigroviridis (length=182 residues).
KMSCGLWKETLALAEDYLSVCCASQMRSLAQDLEQQHQARFHSLAHSFLRQCGLDPCSGLRTVMEELVGDGHLNWGRVVS
LFAFTGVLARLMQEQKSTKPGPDPGLEQDLGQAPGACRALAETIADYLGEERKDWLLENGGWEGFSKFSLSAREVSHDSS
MKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|H3C3G9_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Tetraodon nigroviridis (length=191 residues).
MAREYNRDIVEKYIFHKLSKRGFVWRFEEVQDQNAANNGSVVAPAPTLVRRCHEAGTGPDRGSIPHLCKRTPQSEQHAAI
HRVLREAGDELERLYQPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGAAVCAECAAKEEMSPQVDN
IAEWMTEYLSGSLNSWIQDNGGWRRFKKVTG
>gnl|bcl2dbpro|Q4SCG3_uncBCL2L1-02 Putative BCL2-like 1 protein OS=[Eukaryota] Tetraodon nigroviridis (length=146 residues).
LRKVTDDFEKKLTRACGDLSSYLPSKISHQNFNNTMDQIFEGNVHWGVVIGLFVVGGAMCVQCVRNNHEELVCHIADWMT
AYLDEHLEPWIQRQGGWEDFTRRYETVDERSQFERGAKLCFLTLLLVGGFVIFRKYNVFHRLLRFL
>gnl|bcl2dbpro|Q4SCG3_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Tetraodon nigroviridis (length=207 residues).
MSHTNRELVEFYLNYKLSHSNFLTSLRASADAWQSPRISRRDRSGASPSSDAGRRAVKAVLRKATDDFEKKLTRACGDLS
SYLPSKISHQNFNNTMDQIFEGNVHWGVVIGLFVVGGAMCVQCVRNNHEELVCHIADWMTAYLDEHLEPWIQRQGGWEDF
TRRYETVDERSQFERGAKLCFLTLVLLVGGFVIFRKYNVFHRLLRFL
© 1998-2019