Dataset for protein Mcl-1 of organism Tetraodon nigroviridis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q4SW32_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Tetraodon nigroviridis GN=MCL-1 (length=271 residues).
MSVIANRTAIDTMNVMFQNGVGDADLSSSQIPMGSPRDAFNGNVGDSPKRPSKLTVVKPKVCLSKTIQEDSEDGSLPCTP
ESHSGDVLDVSGRPAGDEAALDSDTRQLVSRLMADVTGISRAQWRESRALATTKRVVGDLMEKHRYTYRGMINKLFMEDR
VGDVSFVGAVAKSTFEDGNTNWGRVASLLAFAAVVAQYLNDHGQRDCVEQVAQEISTYLLTDQRDWLIKNNAWDGFVEFF
QVPDPESTVRTVLMAVAGVAGIGAKLALLIR
© 1998-2019