Dataset for protein BCL-2-like of organism Tetraodon nigroviridis

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|H3CH49_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Tetraodon nigroviridis GN=BCL2L1 (length=232 residues).
RSHPGAKSKGASTQRMSLNRELVIFYIKYKLSQRNYPLSHIVEPSSRTEGQFGTTQSNGTFNGASPGTPPAPSQHQQSLT
SLDAVKEALRDTGNEFELRYTCAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMNP
LVGRIIEWMTVYLDNHIQPWIQSQGGWERFAELFGQDAAAESRRSQERFRNGLFLGMSLAAGIALGSFIVMR
>gnl|bcl2dbpro|Q4SW32_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Tetraodon nigroviridis GN=MCL-1 (length=271 residues).
MSVIANRTAIDTMNVMFQNGVGDADLSSSQIPMGSPRDAFNGNVGDSPKRPSKLTVVKPKVCLSKTIQEDSEDGSLPCTP
ESHSGDVLDVSGRPAGDEAALDSDTRQLVSRLMADVTGISRAQWRESRALATTKRVVGDLMEKHRYTYRGMINKLFMEDR
VGDVSFVGAVAKSTFEDGNTNWGRVASLLAFAAVVAQYLNDHGQRDCVEQVAQEISTYLLTDQRDWLIKNNAWDGFVEFF
QVPDPESTVRTVLMAVAGVAGIGAKLALLIR
© 1998-2019