Dataset for protein Unclassified of organism Tegillarca granosa

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A346FR88_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Tegillarca granosa (length=233 residues).
MATDSQHIGENNGKVTNIYSLKKGSLFAEINKQLGLLPGFQGLSQDLNKLDQETQTPGSSTPLENVRHQAEVIASDVIKS
FVGDCDKKPPNRYCKTMRRTVKELSERHDIAFKGMVNKLNVNDTTAFPTFVSVVDEIFEDGQINWGRIVAVYTFAARLSK
HCNEESPDCDERIALYAGKYVASKLGRWILDNGGWEAFADYFPEQGAMEDKLWKGLVYTAVGLGALATMVASR
© 1998-2019