Dataset for protein Unclassified of organism Takifugu rubripes

[Download (right click)]

5 sequence(s)

>gnl|bcl2dbpro|H2RZ55_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Takifugu rubripes (length=174 residues).
MSNRELVENYLIYKLSQKYPGTVSPPAGTGREALNAALRSMANKYERDFMEQAGDLSPYVAVTRNKAGFNKVMDDMFRDK
INWGTVVGLFVVGGATYVQSFEGGASEPVCHVADWMTDYLDQRINPWIESQGGWVNRRKWILGGLVVLAGVLIIVTKNYG
TLRKAFSNFMSYWS
>gnl|bcl2dbpro|H2SIR7_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Takifugu rubripes (length=213 residues).
TSLKSVYFLNCKTQRNLELVENYLIYKLSQKNYSGTLLRPKGASSGLLVDRESSGASPSAGTGREAVIAALRSMANKFEQ
DFIQLAGDLSSYVAMTRNQACFNKVMDDMFRGEINWGTVVGLFVVGGAICVQSVEGDASEPVCHIADWMAAYLDKRINPW
IESQGGWKPAQSQEERRKWILGGLVVLAGVLIIVTKNYGTLRKAFSHFMSYWS
>gnl|bcl2dbpro|H2SKE0_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Takifugu rubripes (length=225 residues).
MERECNRDIVENYICHKLSKRGFAWSFEDVQDENAANNGSVVAPAPTLVRRCHEAGTGPDRDRGSISHPCKEPPASDQHA
AIHRVLREAGDELERLYQPDFTEMSRQLYLSSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGAVCAECAAKEEMSPQV
DNIAEWMTEYLNGSLNSWIQDNGGWVGVIQRRSRFPRLTRELGDAPLAARQHFLTRNSSADGPRR
>gnl|bcl2dbpro|H2UHW0_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Takifugu rubripes (length=172 residues).
REKCLFGNYLIYKLSQKNYPGTLESSGTSPSTGTGREDVNAALWSMANKFEQDFIQLAGDLSSYGAMTRNQASFNKVMDD
MFSDEINWGTVVGLFVVGGAICGQSVEGDASEPVCHIADWMAAYLDKRINPWIESQGGWVSVKERDSKYSFLCPGILESA
LKQFCLYKTLYK
>gnl|bcl2dbpro|H2UHW1_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Takifugu rubripes (length=220 residues).
SISQRVCRRVGKNGEPQEAGGGAPELVENYLIYKLSQKNYPGTLLRPKDASSGLLVDRESSGTSPSAGTGREAVIAALRS
MANKFEQDFIQLAGDLSSYGAVTRNQASFNKLMDNMFSDEINWGTIVGLFVVGCAICVQSVEGSASQPVCHIADWMTVYL
DKRINPWIENQGGWVSVKERDSKYSFLCAAVRDLMTKIQPLFFFFRMTNGHELIRGIVFI
© 1998-2019