Dataset for protein BCL-2-like of organism Takifugu rubripes

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A3B5K5B3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Takifugu rubripes GN=MCL-1 (length=272 residues).
MNIIANHTALRIMNVVFQNGVVDGAGHSSPLIPMASRGSLSGNDSPKRPSKLSVIAPKVCVAKAIQEDSQDTDHRSAPCT
PEMNSVNGLDVSGRPAEDEAALDNDTRQLLSCFMADFCGIGSHQWRESGALSTMKRVVANLMEKHRYVYNGMTKQLTLDD
RGDDVSFVSSVAKSIFADGVTNWGRIASLVAFGAVVAQHMKDNGRRDCVEPVAQEISTYLLTDRRDWLIKNNGWEGFVEF
FQVSDPESSVRNMLMAVAGVAGLGATLALLIR
>gnl|bcl2dbpro|A0A3B5K6B9_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Takifugu rubripes GN=BCL2L1 (length=218 residues).
MSQNRELVIFYIKYKLSQRNYPFNHNGLILEPPSRTDGQFVTTQFNGTFNGASPGTPPATSLATSLDTVKEALRDTGNEF
ELRYTCAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRIIEWMTVYLDNH
IQPWIQSQGGWVRFAELFGQDAAAESRRSQERFRNGLLVGMSLAAGIAIGSFIVRKLL
>gnl|bcl2dbpro|A0A3B5K6B9_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Takifugu rubripes GN=BCL2L1 (length=218 residues).
MSQNRELVIFYIKYKLSQRNYPFNHNGLILEPPSRTDGQFVTTQFNGTFNGASPGTPPATSLATSLDTVKEALRDTGNEF
ELRYTCAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRIIEWMTVYLDNH
IQPWIQSQGGWVRFAELFGQDAAAESRRSQERFRNGLLVGMSLAAGIAIGSFIVRKLL
>gnl|bcl2dbpro|A0A3B5KD08_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Takifugu rubripes GN=BCL2L10 (length=194 residues).
MSCGLWKETLALAEDYLSLCSTSQCPAPPPPSESATAMRHLGQDMEKQHQARFNSLAQTFLRQCGPDLCSSLRKVMEELV
GDGHLNWGRVVSLFTFTGVLARLMQEQKSTKPGLDPGQEQQLGQVPENCRGLAETIADYLGEEKKDWLLENGGWEGFCKY
SLAAREVNHDSSMKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|H2U5I3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Takifugu rubripes GN=BCL2L1 (length=218 residues).
MSYNNRELVEHFLRYKLSQRNYPTSLLRPEDTDGRTEGEKRSPGASNGLLVRSRNRGGASPSAGAGIEAVNAALRDSAEE
FEKLFAQAFSDLSSQLDITPDTAYQSFKNVMDEVFKDGVNWGRVVGLFAFGGVLCVECVEKDASQLVCRIADWMTIYLDE
HINPWIQSQGGWDCFAKIFGDDAAAEGRRARENLSRWMLGGLALLMGVLVGAFIVKKH
>gnl|bcl2dbpro|H2U5I3_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Takifugu rubripes GN=BCL2L1 (length=218 residues).
MSYNNRELVEHFLRYKLSQRNYPTSLLRPEDTDGRTEGEKRSPGASNGLLVRSRNRGGASPSAGAGIEAVNAALRDSAEE
FEKLFAQAFSDLSSQLDITPDTAYQSFKNVMDEVFKDGVNWGRVVGLFAFGGVLCVECVEKDASQLVCRIADWMTIYLDE
HINPWIQSQGGWDCFAKIFGDDAAAEGRRARENLSRWMLGGLALLMGVLVGAFIVKKH
© 1998-2019