Dataset for protein Bcl-xL of organism Takifugu obscurus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0F7L1T6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Takifugu obscurus GN=BCL2L1 (length=218 residues).
MSYNNRELVEHFLRYKLSQRNYPSSLLRPEDTDGRTEGEKRSPAASNGLLVRSRNRGGASPSAGAGIEAVNAALRDSAEE
FEKLFAQAFSDLSSQLDITPDTAYQSFKNVMDEVFKDGDNWGRVVGLFAFGGVLCVECVERDASQLVCRIADWMTIYLDE
HINPWIQSQGGWDCFAKIFGDDAAAEGRRARENLSRWMLGGLALLMGVLVGAFIVKKH
© 1998-2019